Overview

  • Product name

    Recombinant Human PGCD protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      RKVAQGSRSSLGARSMSDIRSGPSQHLDSPNIGVYEGDRVWLKKFPGDQH IAIRPATKTAFSKLQELRHENVALYLGLFLARGAEGPAALWEGNLAVVSE HCTRGSLQDL
    • Amino acids

      521 to 630
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158620 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CORD6
    • guanylate cyclase 2D membrane (retina-specific)
    • GUC1A4
    • GUC2D
    • LCA
    • LCA1
    • retGC
    • RETGC-1
    • ROS-GC1
    see all
  • Relevance

    In response to G-protein couples receptor stimulation, the cGMP can be produced from GTP by either cytoplasmic, soluble guanylate cyclase (sGC) are heterodimers (ƒÑ & ƒÒ polypeptide chains), that are stimulated by nitric oxide and carbon monoxide or by particulate membrane-bound guanylyl cyclases which are activated by a complex mechanism by natriuretic peptides. Particulate GC (PGCs) have 7 different isoforms, PGC-A through PGC-G and are expressed in most tissues in isoform specific manner. There is significant structural homology among various PGCs, there is a large N-terminal extracellular domain (ECD), a single TMD and a large intracellular domain with protein kinase activity (KLD), a C-terminal catalytic domain (CD) and in between is a dimmerization domain (DD). The particulate GC-D, also known as olfactory gunylate cyclas, is specifically expressed in a subpopulation of olfactory sensory neurons.
  • Cellular localization

    Plasma membrane

Images

  • ab158620 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158620 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158620.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up