Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MSTPGVNSSASLSPDRLNSPVTIPAVMFIFGVVGNLVAIVVLCKSRKEQK ETTFYTLVCGLAVTDLLGTLLVSPVTIATYMKGQWPGGQPLCEYSTFILL FFSLSGLSIICAMSVERYLAINHAYFYSHYVDKRLAGLTLFAVYASNVLF CALPNMGLGSSRLQYPDTWCFIDWTTNVTAHAAYSYMYAGFSSFLILATV LCNVLVCGALLRMHRQFMRRTSLGTEQHHAAAAASVASRGHPAASPALPR LSDFRRRRSFRRIAGAEIQMVILLIATSLVVLICSIPLVVRVFVNQLYQP SLEREVSKNPDLQAIRIASVNPILDPWIYILLRKTVLSKAIEKIKCLFCR IGGSRRERSGQHCSDSQRTSSAMSGHSRSFISRELKEISSTSQTLLPDLS LPDLSENGLGGRNLLPGVPGMGLAQEDTTSLRTLRISETSDSSQGQDSES VLLVDEAGGSGRAGPAPKGSSLQVTFPSETLNLSEKCI
    • Molecular weight

      80 kDa including tags
    • Amino acids

      1 to 488

Specifications

Our Abpromise guarantee covers the use of ab132115 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt

     This product was previously labelled as Prostaglandin E Receptor EP4

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • EP 4
    • EP4
    • EP4R
    • MGC126583
    • PE2R4_HUMAN
    • PGE receptor EP4 subtype
    • PGE2 receptor EP4 subtype
    • Prostaglandin E receptor 4
    • Prostaglandin E receptor 4 subtype EP4
    • Prostaglandin E2 receptor
    • Prostaglandin E2 receptor EP4 subtype
    • Prostanoid EP4 receptor
    • PTGER 2
    • PTGER 4
    • PTGER2
    • PTGER4
    see all
  • Function

    Receptor for prostaglandin E2 (PGE2). The activity of this receptor is mediated by G(s) proteins that stimulate adenylate cyclase. Has a relaxing effect on smooth muscle. May play an important role in regulating renal hemodynamics, intestinal epithelial transport, adrenal aldosterone secretion, and uterine function.
  • Tissue specificity

    High in intestine and in peripheral blood mononuclear cells; low in lung, kidney, thymus, uterus, vasculature and brain. Not found in liver, heart, retina oe skeletal muscle.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132115, stained with Coomassie Blue.

References

ab132115 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132115.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up