Description

  • Product name

    Recombinant Human PGEA1 protein
  • Purity

    > 90 % SDS-PAGE.
    ab204213 was refolded using a unique “temperature shift inclusion body refolding” technology and chromatographically purified.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MASMTGGQQMGRGHHHHHHENLYFQGPFFGNTFSPKKTPPRKSASLSNLH SLDRSTREVELGLEYGSPTMNLAGQSLKFENGQWIAETGVSGGVDRREVQ RLRRRNQQLEEENNLLRLKVDILLDMLSESTAESHLMEKELDELRISRKR K
    • Predicted molecular weight

      17 kDa including tags
    • Amino acids

      2 to 126
    • Tags

      His-T7 tag N-Terminus
    • Additional sequence information

      NP_056188.1. Constructed with codon optimization technology and expressed with a small T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal.

Specifications

Our Abpromise guarantee covers the use of ab204213 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituent: 0.87% Tris HCl

    Contains NaCl, KCl, EDTA, arginine, DTT
    and glycerol.

General Info

  • Alternative names

    • ARPP-binding protein
    • C22orf2
    • CBY
    • Cby1
    • CBY1_HUMAN
    • Cytosolic leucine rich protein
    • Cytosolic leucine-rich protein
    • Golgi and endoplasmic reticulum-associated 1
    • HRIHFB2025
    • PIGEA 14
    • PIGEA-14
    • PKD2 interactor
    • PKD2 interactor, Golgi and endoplasmic reticulum-associated 1
    • Protein Chibby
    • Protein chibby homolog 1
    see all
  • Function

    Inhibits the Wnt/Wingless pathway by binding to beta-catenin and inhibiting beta-catenin-mediated transcriptional activation through competition with TCF/LEF transcription factors. Has also been shown to play a role in regulating the intracellular trafficking of polycystin-2/PKD2 and possibly of other intracellular proteins. Promotes adipocyte and cardiomyocyte differentiation.
  • Tissue specificity

    Widely expressed. Expressed at higher levels in heart, skeletal muscle, kidney and placenta. Also found in brain, lung, liver and testis. Significantly down-regulated in thyroid and metastatic uterine tumors.
  • Sequence similarities

    Belongs to the chibby family.
  • Cellular localization

    Nucleus speckle. Golgi apparatus, trans-Golgi network. Nuclear, in a punctate manner. Also found in the trans-Golgi.
  • Information by UniProt

References

ab204213 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204213.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up