Description

  • Product name

    Recombinant Human PGK1 protein
    See all PGK1 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    Determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 0.100 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      GKDASGNKVKAEPAKIEAFRASLSKLGDVYVNDAFGTAHRAHSSMVGVNL PQKAGGFLMKKELNYFAKALESPERPFLAILGGAKVADKIQLINNMLDKV NEMIIGGGMAFTFLKVLNNMEIGTSLFDEEGAKIVKDLMSKAEKNGVKIT LPVDFVTADKFDENAKTGQATVASGIPAGWMGLDCGPESSKKYAEAVTRA KQIVWNGPVGVFEWEAFARGTKALMDEVVKATSRGCITIIGGGDTATCCA KWNTEDKVSHVSTGGGASLELLEGKVLPGVDALSNILDHHHHHH
    • Predicted molecular weight

      46 kDa including tags
    • Amino acids

      2 to 417
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This product is for the mature full length protein. The initiator methionine is not included.

Specifications

Our Abpromise guarantee covers the use of ab199590 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

General Info

  • Alternative names

    • Cell migration-inducing gene 10 protein
    • Epididymis secretory sperm binding protein Li 68p
    • HEL S 68p
    • MGC117307
    • MGC8947
    • MIG10
    • pgk1
    • PGK1_HUMAN
    • PGKA
    • Phosphoglycerate kinase 1
    • Primer recognition protein 2
    • PRP 2
    see all
  • Function

    In addition to its role as a glycolytic enzyme, it seems that PGK-1 acts as a polymerase alpha cofactor protein (primer recognition protein).
  • Pathway

    Carbohydrate degradation; glycolysis; pyruvate from D-glyceraldehyde 3-phosphate: step 2/5.
  • Involvement in disease

    Defects in PGK1 are the cause of phosphoglycerate kinase 1 deficiency (PGK1D) [MIM:300653]. It is a condition with a highly variable clinical phenotype that includes hemolytic anemia, rhabdomyolysis, myopathy and neurologic involvement. Patients can express one or more of these manifestations.
  • Sequence similarities

    Belongs to the phosphoglycerate kinase family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

References

ab199590 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab199590.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up