Bioactive grade

Recombinant human PGK1 protein (ab211320)

Description

  • Product name

    Recombinant human PGK1 protein
    See all PGK1 proteins and peptides
  • Biological activity

    Specific activity: > 600 units/mg. One unit will convert 1 umole of 1,3-Bisphosphoglycerate to 3-PGA per minute at pH 8.0 at 37°C.

  • Purity

    > 95 % SDS-PAGE.
    ab211320 was purified using conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMSLSNKLTLDKLDVKGKRVVMRVDFNVPMK NNQITNNQRIKAAVPSIKFCLDNGAKSVVLMSHLGRPDGVPMPDKYSLEP VAVELKSLLGKDVLFLKDCVGPEVEKACANPAAGSVILLENLRFHVEEEG KGKDASGNKVKAEPAKIEAFRASLSKLGDVYVNDAFGTAHRAHSSMVGVN LPQKAGGFLMKKELNYFAKALESPERPFLAILGGAKVADKIQLINNMLDK VNEMIIGGGMAFTFLKVLNNMEIGTSLFDEEGAKIVKDLMSKAEKNGVKI TLPVDFVTADKFDENAKTGQATVASGIPAGWMGLDCGPESSKKYAEAVTR AKQIVWNGPVGVFEWEAFARGTKALMDEVVKATSRGCITIIGGGDTATCC AKWNTEDKVSHVSTGGGASLELLEGKVLPGVDALSNI
    • Predicted molecular weight

      47 kDa including tags
    • Amino acids

      1 to 417
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_000282.

Specifications

Our Abpromise guarantee covers the use of ab211320 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

    Functional Studies

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.32% Tris HCl, 10% Glycerol, 0.02% DTT

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • Cell migration-inducing gene 10 protein
    • Epididymis secretory sperm binding protein Li 68p
    • HEL S 68p
    • MGC117307
    • MGC8947
    • MIG10
    • pgk1
    • PGK1_HUMAN
    • PGKA
    • Phosphoglycerate kinase 1
    • Primer recognition protein 2
    • PRP 2
    see all
  • Function

    In addition to its role as a glycolytic enzyme, it seems that PGK-1 acts as a polymerase alpha cofactor protein (primer recognition protein).
  • Pathway

    Carbohydrate degradation; glycolysis; pyruvate from D-glyceraldehyde 3-phosphate: step 2/5.
  • Involvement in disease

    Defects in PGK1 are the cause of phosphoglycerate kinase 1 deficiency (PGK1D) [MIM:300653]. It is a condition with a highly variable clinical phenotype that includes hemolytic anemia, rhabdomyolysis, myopathy and neurologic involvement. Patients can express one or more of these manifestations.
  • Sequence similarities

    Belongs to the phosphoglycerate kinase family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab211320 (3µg).   

References

ab211320 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab211320.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up