Description

  • Product name

    Recombinant Human PGM1 protein
  • Purity

    > 95 % SDS-PAGE.
    Purified by using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMVKIVTVKTQAYQDQKPGTSGLRKRVK VFQSSANYAENFIQSIISTVEPAQRQEATLVVGGDGRFYMKEAIQLIARI AAANGIGRLVIGQNGILSTPAVSCIIRKIKAIGGIILTASHNPGGPNGDF GIKFNISNGGPAPEAITDKIFQISKTIEEYAVCPDLKVDLGVLGKQQFDL ENKFKPFTVEIVDSVEAYATMLRSIFDFSALKELLSGPNRLKIRIDAMHG VVGPYVKKILCEELGAPANSAVNCVPLEDFGGHHPDPNLTYAADLVETMK SGEHDFGAAFDGDGDRNMILGKHGFFVNPSDSVAVIAANIFSIPYFQQTG VRGFARSMPTSGALDRVASATKIALYETPTGWKFFGNLMDASKLSLCGEE SFGTGSDHIREKDGLWAVLAWLSILATRKQSVEDILKDHWQKYGRNFFTR YDYEEVEAEGANKMMKDLEALMFDRSFVGKQFSANDKVYTVEKADNFEYS DPVDGSISRNQGLRLIFTDGSRIVFRLSGTGSAGATIRLYIDSYEKDVAK INQDPQVMLAPLISIALKVSQLQERTGRTAPTVIT
    • Predicted molecular weight

      64 kDa including tags
    • Amino acids

      1 to 562
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_002624.

Specifications

Our Abpromise guarantee covers the use of ab207115 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 10% Glycerol, PBS

General Info

  • Alternative names

    • CDG1T
    • Glucose phosphomutase 1
    • GSD14
    • OTTHUMP00000010519
    • OTTHUMP00000010520
    • PGM 1
    • PGM1
    • PGM1_HUMAN
    • Phosphoglucomutase 1
    • Phosphoglucomutase-1
    • Phosphoglucomutase1
    see all
  • Function

    This enzyme participates in both the breakdown and synthesis of glucose.
  • Involvement in disease

    Defects in PGM1 are the cause of glycogen storage disease type 14 (GSD14) [MIM:612934]. A metabolic disorder resulting in a myopathy characterized by exercise-induced intolerance with episodes of rhabdomyolysis, normal elevation of lactate, and hyperammonemia on a forearm-exercise test.
  • Sequence similarities

    Belongs to the phosphohexose mutase family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab207115 (3µg).

References

ab207115 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab207115.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up