Description

  • Product name

    Recombinant Human PGM2 protein
  • Purity

    > 85 % SDS-PAGE.
    purified by using conventional chromatography techniques
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMAAPEGSGLGEDARLDQETAQWLRWDK NSLTLEAVKRLIAEGNKEELRKCFGARMEFGTAGLRAAMGPGISRMNDLT IIQTTQGFCRYLEKQFSDLKQKGIVISFDARAHPSSGGSSRRFARLAATT FISQGIPVYLFSDITPTPFVPFTVSHLKLCAGIMITASHNPKQDNGYKVY WDNGAQIISPHDKGISQAIEENLEPWPQAWDDSLIDSSPLLHNPSASINN DYFEDLKKYCFHRSVNRETKVKFVHTSVHGVGHSFVQSAFKAFDLVPPEA VPEQKDPDPEFPTVKYPNPEEGKGVLTLSFALADKTKARIVLANDPDADR LAVAEKQDSGEWRVFSGNELGALLGWWLFTSWKEKNQDRSALKDTYMLSS TVSSKILRAIALKEGFHFEETLTGFKWMGNRAKQLIDQGKTVLFAFEEAI GYMCCPFVLDKDGVSAAVISAELASFLATKNLSLSQQLKAIYVEYGYHIT KASYFICHDQETIKKLFENLRNYDGKNNYPKACGKFEISAIRDLTTGYDD SQPDKKAVLPTSKSSQMITFTFANGGVATMRTSGTEPKIKYYAELCAPPG NSDPEQLKKELNELVSAIEEHFFQPQKYNLQPKAD
    • Predicted molecular weight

      71 kDa including tags
    • Amino acids

      1 to 612
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_060760

Specifications

Our Abpromise guarantee covers the use of ab201877 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 90% PBS, 10% Glycerol

General Info

  • Alternative names

    • FLJ10983
    • Glucose phosphomutase 2
    • MSTP006
    • PGM 2
    • Phosphodeoxyribomutase
    • Phosphoglucomutase 2
    see all
  • Relevance

    Phosphoglucomutase 2 (PGM2) participates in both the breakdown and synthesis of glucose.
  • Cellular localization

    Cytoplasmic

Images

  • 15% SDS Page analysis of ab201877 (3µg).

References

ab201877 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201877.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up