Overview

  • Product name

    Recombinant Human PGM2L1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MAENTEGDLNSNLPHAPYHTGDPQLDTAIGQWLRWDKNPKTKEQIENLLR NGMNKELRDRLCCRMTFGTAGLRSAMGAGFCYINDLTVIQSTQGMYKYLE RCFSDFKQRGFVVGYDTRGQVTSSCSSQRLAKLTAAVLLAKDVPVYLFSR YVPTPFVPYAVQKLKAVAGVMITASHNRKEDNGYKVYWETGAQITSPHDK EILKCIEECVEPWNGSWNDNLVDTSPLKRDPLQDICRRYMEDLKKICFYR ELNSKTTLKFVHTSFHGVGHDYVQLAFKVFGFKPPIPVPEQKDPDPDFST VKCPNPEEGESVLELSLRLAEKENARVVLATDPDADRLAAAELQENGCWK VFTGNELAALFGWWMFDCWKKNKSRNADVKNVYMLATTVSSKILKAIALK EGFHFEETLPGFKWIGSRIIDLLENGKEVLFAFEESIGFLCGTSVLDKDG VSAAVVVAEMASYLETMNITLKQQLVKVYEKYGYHISKTSYFLCYEPPTI KSIFERLRNFDSPKEYPKFCGTFAILHVRDITTGYDSSQPNKKSVLPVSK NSQMITFTFQNGCVATLRTSGTEPKIKYYAEMCASPDQSDTALLEEELKK LIDALIENFLQPSKNGLIWRSV
    • Amino acids

      1 to 622
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166124 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • BM32A
    • Glucose 1,6-Bisphosphate Synthase
    • Phosphoglucomutase 2 like 1
    • PMMLP
  • Relevance

    PGM2L1 belongs to the phosphohexose mutase family. It is a glucose 1,6-bisphosphate synthase using 1,3-bisphosphoglycerate as a phosphate donor and a series of 1-phosphate sugars as acceptors, including glucose 1-phosphate, mannose 1-phosphate, ribose 1-phosphate and deoxyribose 1-phosphate. It does not use 5 or 6-phosphosugars as they are bad substrates, with the exception of glucose 6-phosphate. PGM2L1 also synthesizes ribose 1,5-bisphosphate. It has only low phosphopentomutase and phosphoglucomutase activities.
  • Cellular localization

    Cytoplasmic

Images

  • ab166124 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166124 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166124.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up