Recombinant Human PGRMC1 protein (ab161175)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KVFDVTKGRKFYGPEGPYGVFAGRDASRGLATFCLDKEALKDEYDDLSDL TAAQQETLSDWESQFTFKYHHVGKLLKEGEEPTVYSDEEEPKDESARKND
    • Amino acids
      96 to 195
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161175 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • HPR6.6
    • Membrane associated progesterone receptor component 1
    • Membrane-associated progesterone receptor component 1
    • mPR
    • PGRC1_HUMAN
    • PGRMC
    • Pgrmc1
    • Progesterone binding protein
    • Progesterone receptor membrane component 1
    see all
  • Function
    Receptor for progesterone.
  • Tissue specificity
    Widely expressed, with highest expression in liver and kidney.
  • Sequence similarities
    Belongs to the cytochrome b5 family. MAPR subfamily.
    Contains 1 cytochrome b5 heme-binding domain.
  • Domain
    The cytochrome b5 heme-binding domain lacks the conserved iron-binding His residues at positions 107 and 131.
  • Cellular localization
    Microsome membrane. Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • ab161175 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161175 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161175.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up