Recombinant Human PGRPS protein (BSA and azide free) (ab175469)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      QETEDPACCSPIVPRNEWKALASECAQHLSLPLRYVVVSHTAGSSCNTPA SCQQQARNVQHYHMKTLGWCDVGYNFLIGEDGLVYEGRGWNFTGAHSGHL WNPMSIGISFMGNYMDRVPTPQAIRAAQGLLACGVAQGALRSNYVLKGHR DVQRTLSPGNQLYHLIQNWPHYRSP
    • Molecular weight
      21 kDa including tags
    • Amino acids
      22 to 196
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab175469 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    Mass Spectrometry

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Mass spectrometry
    LC-MS/MS
  • Purity
    > 90 % Densitometry.
    ab175469 was purifed using Ni-NTA chromatography.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at Room Temperature. Store at +4°C short term (1-2 weeks). Store at -80°C. Avoid freeze / thaw cycle.

    Information available upon request.

  • Reconstitution
    Add 200 µl of 0.1M Acetate buffer pH=4.0 to prepare a working stock solution of 0.5 mg/mL.

General Info

  • Alternative names
    • MGC126894
    • MGC126896
    • Peptidoglycan recognition protein
    • Peptidoglycan recognition protein 1
    • Peptidoglycan recognition protein short
    • PGLYRP
    • PGLYRP1
    • PGRP
    • PGRP S
    • PGRP-S
    • PGRP1_HUMAN
    • PHRP, short
    • SBBI68
    • TAG7
    • TNF superfamily, member 3 (LTB)-like (peptidoglycan recognition protein)
    • TNFSF 3L
    • TNFSF3L
    • UNQ639/PRO1269
    see all
  • Function
    Pattern receptor that binds to murein peptidoglycans (PGN) of Gram-positive bacteria. Has bactericidal activity towards Gram-positive bacteria. May kill Gram-positive bacteria by interfering with peptidoglycan biosynthesis. Binds also to Gram-negative bacteria, and has bacteriostatic activity towards Gram-negative bacteria. Plays a role in innate immunity.
  • Tissue specificity
    Highly expressed in bone marrow. Weak expression found in kidney, liver, small intestine, spleen, thymus, peripheral leukocyte, lung, fetal spleen and neutrophils.
  • Sequence similarities
    Belongs to the N-acetylmuramoyl-L-alanine amidase 2 family.
  • Post-translational
    modifications
    N-glycosylated. N-glycosylation is required for bactericidal activity.
  • Cellular localization
    Secreted. Cytoplasmic granule.
  • Information by UniProt

Images

  • 14% SDS-PAGE analysis of ab175469

     

    Lane 1: reduced and heated sample (2.5 μg)

    Lane 2: Non-reduced and non-heated sample (2.5 μg)

References

ab175469 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab175469.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up