Overview

  • Product name

    Recombinant Human PGT protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      FFFPRAMPIGAKRAPATADEARKLEEAKSRGSLVDFIKRFPCIFLRLLMN
    • Amino acids

      276 to 325
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159536 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as SLCO2A1. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • MATR1
    • Matrin F/G 1
    • OATP2A1
    • PGT
    • PHOAR2
    • Prostaglandin transporter
    • SLC21A2
    • SLCO2A1
    • Solute carrier family 21 (prostaglandin transporter) member 2
    • Solute carrier family 21 member 2
    • Solute carrier organic anion transporter family member 2A1
    see all
  • Cellular localization

    Cell Membrane

Images

  • ab159536 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159536 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159536.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up