Overview

  • Product name

    Recombinant Human PHAPI2 / APRIL protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MDMKRRIHLELRNRTPAAVRELVLDNCKSNDGKIEGLTAEFVNLEFLSLI NVGLISVSNLPKLPKLKKLELSENRIFGGLDMLAEKLPNLTHLNLSGNKL KDISTLEPLKKLECLKSLDLFNCEVTNLNDYRESVFKLLPQLTYLDGYDR EDQEAPDSDAEVDGVDEEEEDEEGEDEEDEDDEDGEEEEFDEEDDEDEDV EGDEDDDEVSEEEEEFGLDEEDEDEDEDEEEEEGGKGEKRKRETDDEGED D
    • Molecular weight

      55 kDa including tags
    • Amino acids

      1 to 251

Associated products

Specifications

Our Abpromise guarantee covers the use of ab133003 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Acidic (leucine rich) nuclear phosphoprotein 32 family member B
    • Acidic leucine rich nuclear phosphoprotein 32 family member B
    • Acidic leucine-rich nuclear phosphoprotein 32 family member B
    • Acidic nuclear phosphoprotein 32 family member B
    • Acidic protein rich in leucines
    • AN32B_HUMAN
    • ANP 32B
    • ANP32B
    • APRIL
    • OTTHUMP0000006377
    • PAL 31
    • PAL31
    • PHAPI 2
    • PHAPI2
    • PHAPI2 protein
    • PHAPI2a
    • Proliferation related acidic leucine rich protein
    • Putative HLA-DR-associated protein I-2
    • Silver stainable protein SSP 29
    • Silver stainable protein SSP29
    • Silver-stainable protein SSP29
    • Ssp 29
    • Ssp29
    see all
  • Function

    Multifunctional protein working as a cell cycle progression factor as well as a cell survival factor. Required for the progression from the G1 to the S phase. Anti-apoptotic protein which functions as a caspase-3 inhibitor. Has no phosphatase 2A (PP2A) inhibitor activity (By similarity). Exhibits histone chaperone properties, stimulating core histones to assemble into a nucleosome.
  • Tissue specificity

    Expressed in heart, lung, pancreas, prostate and in spleen, thymus and placenta.
  • Sequence similarities

    Belongs to the ANP32 family.
    Contains 4 LRR (leucine-rich) repeats.
    Contains 1 LRRCT domain.
  • Domain

    Histone binding is mediated by the concave surface of the LRR region.
  • Post-translational
    modifications

    Some glutamate residues are glycylated by TTLL8. This modification occurs exclusively on glutamate residues and results in a glycine chain on the gamma-carboxyl group.
  • Cellular localization

    Nucleus. Accumulates in the nuclei at the S phase and Cytoplasm. Lacks a nuclear localization signal.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab133003 stained with Coomassie Blue.

References

ab133003 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab133003.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up