Overview

  • Product name

    Recombinant Human PHD finger protein 6/PHF6
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MSSSVEQKKGPTRQRKCGFCKSNRDKECGQLLISENQKVAAHHKCMLFSS ALVSSHSDNESLGGFSIEDVQKEIKRGTKLMCSLCHCPGATIGCDVKTCH RTYHYHCALHDKAQIREKPSQGIYMAYCRKHKKTAHNSEAADLEESFNEH ELEPSSPKSKKKSRKGRPRKTNFKGLSEDTRSTSSHGTDEMESSSYRDRS PHRSSPSDTRPKCGFCHVGEEENEARGKLHIFNAKKAAAHYKCMLFSSGT VQLTTTSRAEFGDFDIKTVLQEIKRGKRMVCSFYICYATLHLICCFKFRV HPKFIQSSENLK
    • Amino acids

      1 to 312
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164560 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as PHD finger protein 6

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • AC004383.6
    • BFLS
    • BORJ
    • CENP 31
    • Centromere protein 31
    • MGC14797
    • OTTHUMP00000024063
    • PHD finger protein 6
    • PHD like zinc finger protein
    • PHD-like zinc finger protein
    • Phf6
    • PHF6_HUMAN
    see all
  • Function

    May play a role in transcriptional regulation.
  • Tissue specificity

    Ubiquitously expressed.
  • Involvement in disease

    Defects in PHF6 are the cause of Boerjeson-Forssman-Lehmann syndrome (BFLS) [MIM:301900]; also known as Boerjeson-Forssman syndrome (BORJ). BFLS is a X-linked recessive disorder characterized by moderate to severe mental retardation, epilepsy, hypogonadism, hypometabolism, obesity with marked gynecomastia, swelling of subcutaneous tissue of the face, narrow palpebral fissure and large but not deformed ears.
  • Sequence similarities

    Contains 2 PHD-type zinc fingers.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Nucleus. Nucleus > nucleolus. Nuclear, it particularly localizes to the nucleolus.
  • Information by UniProt

Images

  • ab164560 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164560 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164560.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up