Overview

  • Product name

    Recombinant Human PHD1/prolyl hydroxylase protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MDSPCQPQPLSQALPQLPGSSSEPLEPEPGRARMGVESYLPCPLLPSYHC PGVPSEASAGSGTPRATATSTTASPLRDGFGGQDGGELRPLQSEGAAALV TKGCQRLAAQGARPEAPKRKWAEDGGDAPSPSKRPWARQENQEAEREGGM SCSCSSGSGEASAGLMEEALPSAPERLALDYIVPCMRYYGICVKDSFLGA ALGGRVLAEVEALKRGGRLRDGQLVSQRAIPPRSIRGDQIAWVEGHEPGC RSIGALMAHVDAVIRHCAGRLGSYVINGRTKAMVACYPGNGLGYVRHVDN PHGDGRCITCIYYLNQNWDVKVHGGLLQIFPEGRPVVANIEPLFDRLLIF WSDRRNPHEVKPAYATRYAITVWYFDAKERAAAKDKYQLASGQKGVQVPV SQPPTPT
    • Molecular weight

      71 kDa including tags
    • Amino acids

      1 to 407

Specifications

Our Abpromise guarantee covers the use of ab132272 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • DKFZp434E026
    • EGL nine (C.elegans) homolog 2
    • Egl nine homolog 2
    • Egl nine homolog 2 (C. elegans)
    • EGLN 2
    • EGLN2
    • EGLN2_HUMAN
    • EIT 6
    • EIT6
    • Estrogen-induced tag 6
    • HIF P4H 1
    • HIF PH1
    • HIF prolyl hydroxylase 1
    • HIF-PH1
    • HIF-prolyl hydroxylase 1
    • HIFPH 1
    • HIFPH1
    • HPH 3
    • HPH-1
    • HPH-3
    • HPH3
    • Hypoxia inducible factor prolyl hydroxylase 1
    • Hypoxia-inducible factor prolyl hydroxylase 1
    • P4H1
    • PHD 1
    • PhD1
    • prolyl hydroxylase domain containing protein 1
    • Prolyl hydroxylase domain-containing protein 1
    see all
  • Function

    Catalyzes the post-translational formation of 4-hydroxyproline in hypoxia-inducible factor (HIF) alpha proteins. Hydroxylates HIF-1 alpha at 'Pro-402' and 'Pro-564', and HIF-2 alpha. Functions as a cellular oxygen sensor and, under normoxic conditions, targets HIF through the hydroxylation for proteasomal degradation via the von Hippel-Lindau ubiquitination complex. May play a role in cell growth regulation. Isoform p40 and isoform p43 exhibit the same level of activity.
  • Tissue specificity

    Expressed abundantly in all tissues with highest expression in testis. Expressed in hormone responsive tissues, including normal and cancerous mammary, ovarian and prostate epithelium.
  • Sequence similarities

    Contains 1 Fe2OG dioxygenase domain.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132272 stained with Coomassie Blue.

References

ab132272 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132272.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up