Description

  • Product name

    Recombinant Human PHD2 / prolyl hydroxylase protein
    See all PHD2 / prolyl hydroxylase proteins and peptides
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPE GKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERAR AKVKYLTGEKGVRVELNKPSDSVGKDVF
    • Predicted molecular weight

      41 kDa including tags
    • Amino acids

      299 to 426
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab132273 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl
    Note: Glutathione is reduced.

General Info

  • Alternative names

    • C1ORF12
    • Chromosome 1 Open Reading Frame 12
    • DKFZp761F179
    • ECYT 3
    • ECYT3
    • Egl 9 family hypoxia inducible factor 1
    • EGL 9 homolog of C. elegans 1
    • EGL nine (C.elegans) homolog 1
    • Egl nine homolog 1
    • Egl nine homolog 1 (C. elegans)
    • Egl nine like protein 1
    • EGLN 1
    • Egln1
    • EGLN1_HUMAN
    • HIF PH2
    • HIF Prolyl Hydroxylase 2
    • HIF-PH2
    • HIF-prolyl hydroxylase 2
    • HIFP4H 2
    • HIFPH2
    • HPH 2
    • HPH-2
    • HPH2
    • Hypoxia inducible factor prolyl hydroxylase 2
    • Hypoxia-inducible factor prolyl hydroxylase 2
    • ORF13
    • P4H2
    • PHD 2
    • PhD2
    • PNAS 118
    • PNAS 137
    • Prolyl Hydroxylase Domain Containing Protein 2
    • Prolyl hydroxylase domain-containing protein 2
    • Rat Homolog of SM20
    • SM 20
    • SM-20
    • SM20
    • Zinc finger MYND domain containing protein 6
    • ZMYND6
    see all
  • Function

    Catalyzes the post-translational formation of 4-hydroxyproline in hypoxia-inducible factor (HIF) alpha proteins. Hydroxylates HIF-1 alpha at 'Pro-402' and 'Pro-564', and HIF-2 alpha. Functions as a cellular oxygen sensor and, under normoxic conditions, targets HIF through the hydroxylation for proteasomal degradation via the von Hippel-Lindau ubiquitination complex.
  • Tissue specificity

    According to PubMed:11056053, widely expressed with highest levels in skeletal muscle and heart, moderate levels in pancreas, brain (dopaminergic neurons of adult and fetal substantia nigra) and kidney, and lower levels in lung and liver. According to PubMed:12351678 widely expressed with highest levels in brain, kidney and adrenal gland. Expressed in cardiac myocytes, aortic endothelial cells and coronary artery smooth muscle.
  • Involvement in disease

    Defects in EGLN1 are the cause of erythrocytosis familial type 3 (ECYT3) [MIM:609820]. ECYT3 is an autosomal dominant disorder characterized by increased serum red blood cell mass, elevated serum hemoglobin and hematocrit, and normal serum erythropoietin levels.
  • Sequence similarities

    Contains 1 Fe2OG dioxygenase domain.
    Contains 1 MYND-type zinc finger.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132273 stained with Coomassie Blue.

References

ab132273 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132273.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up