Recombinant Human PHD4/prolyl hydroxylase protein (ab162816)

Overview

  • Product name
    Recombinant Human PHD4/prolyl hydroxylase protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAAAAVTGQRPETAAAEEASRPQWAPPDHCQAQAAAGLGDGEDAPVRPLC KPRGICSRAYFLVLMVFVHLYLGNVLALLLFVHYSNGDESSDPGPQHRAQ GPGPEPTLGPLTRLEGIKVGHERKVQLVTDRDHFIRTLSLKPLLFEIPGF LTDEECRLIIHLAQMKGLQRSQILPTEEYEEAMSTMQVSQLDLFRLLDQN RDGHLQLREVLAQTRLGNGWWMTPESIQEMYAAIKADPDGDGVLSLQEFS NMDLRDFHKYMRSHKAESSELVRNSHHTWLYQGEGAHHIMRAIRQRVLRL TRLSPEIVELSEPLQVVRYGEGGHYHAHVDSGPVYPETICSHTKLVANES VPFETSCRQVSPNWGLPSILRPGTPMTQAQPCTVGVPLGMGPGDHWVIPV SPWEHPQLGTCSVPPLPYSYMTVLFYLNNVTGGGETVFPVADNRTYDEMS LIQDDVDLRDTRRHCDKGNLRVKPQQGTAVFWYNYLPDGQGWVGDVDDYS LHGGCLVTRGTKWIANNWINVDPSRARQALFQQEMARLAREGGTDSQPEW ALDRAYRDARVEL
    • Amino acids
      1 to 563
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162816 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • EGLN4
    • HIF PH4
    • HIF Prolyl Hydroxylase 4
    • HIF prolyl hydroxylase PH 4
    • HIF prolyl hydroxylase PH4
    • HIF-PH4
    • HIF-prolyl hydroxylase 4
    • HIFPH4
    • HPH 4
    • HPH-4
    • Hypoxia inducible factor prolyl 4 hydroxylase
    • Hypoxia-inducible factor prolyl hydroxylase 4
    • P4H with transmembrane domain
    • P4H-TM
    • P4htm
    • P4HTM_HUMAN
    • PH 4
    • PH4
    • PHD 4
    • Proline 4 hydroxylase
    • prolyl 4-hydroxylase
    • Transmembrane prolyl 4-hydroxylase
    see all
  • Function
    Catalyzes the post-translational formation of 4-hydroxyproline in hypoxia-inducible factor (HIF) alpha proteins. Hydroxylates HIF1A at 'Pro-402' and 'Pro-564'. May function as a cellular oxygen sensor and, under normoxic conditions, may target HIF through the hydroxylation for proteasomal degradation via the von Hippel-Lindau ubiquitination complex.
  • Tissue specificity
    Widely expressed with highest levels in adult pancreas, heart, skeletal muscle, brain, placenta, kidney and adrenal gland. Expressed at lower levels in epiphyseal cartilage and in fibroblasts.
  • Sequence similarities
    Contains 2 EF-hand domains.
    Contains 1 Fe2OG dioxygenase domain.
  • Post-translational
    modifications
    Glycosylated.
  • Cellular localization
    Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • ab162816 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162816 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162816.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up