Description

  • Product name

    Recombinant Human PHF20L1 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSKKPPNRPGITFEIGARLEALDYLQKWYPSRIEKIDYEEGKMLVHFERW SHRYDEWIYWDSNRLRPLERPALRKEGLKDEEDFFDFKAGEEVLARWTDC RYYPAKIEAINKEGTFTVQFYDGVIRCLKRMHIKAMPEDAKGQDWIALVK AAAAAAAKNKTGSKPRTSANSNKDKDKDERKWFKVPSKKEETSTCIATPD VEKKEDLPTSSETFGLHVENVPKMVFPQPESTLSNKRKNNQGNSFQAKRA RLNKITGLLASKAVGVDGAEKKEDYNETAPMLEQV
    • Predicted molecular weight

      59 kDa including tags
    • Amino acids

      1 to 285

Specifications

Our Abpromise guarantee covers the use of ab132748 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CGI 72
    • MGC64923
    • OTTHUMP00000192870
    • OTTHUMP00000192871
    • OTTHUMP00000192872
    • OTTHUMP00000192874
    • OTTHUMP00000192875
    • OTTHUMP00000192876
    • OTTHUMP00000192877
    • OTTHUMP00000227156
    • P20L1_HUMAN
    • PHD finger protein 20 like 1
    • PHD finger protein 20 like 1, isoform CRA_a
    • PHD finger protein 20-like protein 1
    • PHF20L1
    • PHF20L1 protein
    • PHF20L1 transcript variant 3, mRNA
    • TDRD20B
    • Tudor domain containing 20B
    • tudor domain-containing protein PHF20L1
    • Uncharacterized protein PHF20L1
    see all
  • Sequence similarities

    Contains 1 PHD-type zinc finger.
    Contains 2 Tudor domains.
  • Information by UniProt

Images

  • ab132748 on 12.5% SDS-PAGE stained with Coomassie blue.

References

ab132748 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132748.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up