Recombinant Human PHF21B protein (ab164987)

Overview

  • Product name
    Recombinant Human PHF21B protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MELQSRPEALAVELARHQNGDLKKQLHERQPRIAALSDKQALGTITAVPV TGPQVSSLQRLAGQGAAVLPQVRPKTLIPDSLPVAPGRDRPPKQPPTFQK ATVVSVKNPSPALPTANNTVSHVPAPGSQPQALAEPAALASPLSSAGVAY AIISTSPSNAAAMAPSTAVSVVSDSIKVQPLLISADNKPPPRLLSSPHPA THHCPLHPSSLPLTPPSPSLSPSPLHGIFQVIIIQPQVQTQPESTAESRP PTEEPSQGAQATKKKKEDRPPTQENPEKIAFMVALGLVTTEHLEEIQSKR QERKRRSTANPAYSGLLETERKRLASNYLNNPLFLTARANEDPCWKNEIT HDEHCAACKRGANLQPCGTCPGAYHLSCLEPPLKTAPKGVWVCPRCQQKA LKKDEGVPWTGMLAIVHSYVTHKTVKEEEKQKLLQRGSELQNEHQQLEER DRRLASAVQKCLELKTSLLARQRGTQSSLDRLRALLRLIQGEQLLQVTMT TTSPAPLLAGPWTKPSVAATHPTVQHPQGHN
    • Amino acids
      1 to 531
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164987 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • A730032D07Rik
    • AL049760.6
    • BHC80L
    • FLJ34161
    • OTTHUMP00000199355
    • OTTHUMP00000199357
    • PF21B_HUMAN
    • PHD finger protein 21B
    • PHD finger protein 4
    • Phf21b
    • PHF4
    • RGD1308739
    see all
  • Sequence similarities
    Contains 1 PHD-type zinc finger.
  • Information by UniProt

Images

  • ab164987 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164987 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164987.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up