Recombinant Human PHF5A protein (ab164670)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECN YGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFY ERKKYGFKKR
    • Amino acids
      1 to 110
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164670 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 1110007B08Rik
    • Ac2 246
    • bK223H9.2
    • INI
    • MGC1346
    • OTTHUMP00000198827
    • PHD finger 5a
    • PHD finger like domain containing protein 5A
    • PHD finger like domain protein 5A
    • PHD finger protein 5A
    • PHD finger-like domain protein 5A
    • PHD finger-like domain-containing protein 5A
    • Phf5a
    • PHF5A_HUMAN
    • Rds3
    • SAP14b
    • SF3b14b
    • Splicing factor 3B associated 14 kDa protein
    • Splicing factor 3B-associated 14 kDa protein
    • Transcription factor INI
    see all
  • Function
    Acts as a transcriptional regulator by binding to the GJA1/Cx43 promoter and enhancing its up-regulation by ESR1/ER-alpha. Also involved in pre-mRNA splicing.
  • Sequence similarities
    Belongs to the PHF5 family.
  • Cellular localization
    Nucleus. Nucleus speckle.
  • Information by UniProt

Images

  • ab164670 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164670 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164670.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up