Recombinant Human PHF5A protein (ab167841)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMAKHHPDLIFCRKQAGVAIGRLCEKCD GKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTI QEKDRDGCPKIVNLGSSKTDLFYERKKYGFKKR
    • Molecular weight
      15 kDa including tags
    • Amino acids
      1 to 110
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab167841 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 85 % SDS-PAGE.
    ab167841 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.02% DTT, 0.32% Tris HCl, 10% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names
    • 1110007B08Rik
    • Ac2 246
    • bK223H9.2
    • INI
    • MGC1346
    • OTTHUMP00000198827
    • PHD finger 5a
    • PHD finger like domain containing protein 5A
    • PHD finger like domain protein 5A
    • PHD finger protein 5A
    • PHD finger-like domain protein 5A
    • PHD finger-like domain-containing protein 5A
    • Phf5a
    • PHF5A_HUMAN
    • Rds3
    • SAP14b
    • SF3b14b
    • Splicing factor 3B associated 14 kDa protein
    • Splicing factor 3B-associated 14 kDa protein
    • Transcription factor INI
    see all
  • Function
    Acts as a transcriptional regulator by binding to the GJA1/Cx43 promoter and enhancing its up-regulation by ESR1/ER-alpha. Also involved in pre-mRNA splicing.
  • Sequence similarities
    Belongs to the PHF5 family.
  • Cellular localization
    Nucleus. Nucleus speckle.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab167841 (3µg).

References

ab167841 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167841.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up