Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MKTVKEKKECQRLRKSAKTRRVTQRKPSSGPVCWLCLREPGDPEKLGEFL QKDNISVHYFCLILSSKLPQRGQSNRGFHGFLPEDIKKEAARASRKICFV CKKKGAAINCQKDQCLRNFHLPCGQERGCLSQFFGEYKSFCDKHRPTQNI QHGHVGEESCILCCEDLSQQSVENIQSPCCSQAIYHRKCIQKYAHTSAKH FFKCPQCNNRKEFPQEMLRMGIHIPDRDAAWELEPGAFSDLYQRYQHCDA PICLYEQGRDSFEDEGRWCLILCATCGSHGTHRDCSSLRSNSKKWECEEC SPAAATDYIPENSGDIPCCSSTFHPEEHFCRDNTLEENPGLSWTDWPEPS LLEKPESSRGRRSYSWRSKGVRITNSCKKSK
    • Molecular weight

      70 kDa including tags
    • Amino acids

      1 to 381

Specifications

Our Abpromise guarantee covers the use of ab132754 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • DKFZp434L1850
    • HSPC045
    • HSPC226
    • MGC26088
    • NYD SP6
    • OTTHUMP00000212988
    • OTTHUMP00000212989
    • OTTHUMP00000212990
    • OTTHUMP00000212993
    • PHD finger protein 7
    • Phf7
    • PHF7_HUMAN
    • Testis development protein NYD SP6
    • Testis development protein NYD-SP6
    see all
  • Function

    May play a role in spermatogenesis.
  • Tissue specificity

    Highly expressed in Sertoli cells, but not in germ cells in adult testis. Expression in embryonic testis is 30-times lower. Highly expressed in colon, spleen, white blood cells, pancreas, lung, liver, placenta and brain. Detected at lower levels in thymus, small intestine, ovary and kidney.
  • Sequence similarities

    Contains 1 PHD-type zinc finger.
    Contains 1 RING-type zinc finger.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab132754 on 12.5% SDS-PAGE stained with Coomassie blue.

References

ab132754 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132754.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up