Description

  • Product name

    Recombinant Human PHIP protein
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MHHHHHHSLIYKPLDGEWGTNPRDEECERIVAGINQLMTLDIASAFVAPV DLQAYPMYCTVVAYPTDLSTIKQRLENRFYRRVSSLMWEVRYIEHNTRTF NEPGSPIVKSAKFVTDLLLHFIKDQTCYNIIPLYNSMKKKVLSDSEDEE
    • Predicted molecular weight

      17 kDa including tags
    • Amino acids

      1146 to 1287
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Bromodomain 1 (NM_017934).

Specifications

Our Abpromise guarantee covers the use of ab196110 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C.

    pH: 8.00
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 20% Glycerol

General Info

  • Alternative names

    • DCAF14
    • DDB1 and CUL4 associated factor 14
    • FLJ20705
    • FLJ45918
    • IRS 1 PH domain binding protein
    • IRS1 PH domain binding protein
    • MGC90216
    • Ndrp
    • Neuronal differentiation related protein
    • PH interacting protein
    • Pleckstrin homology domain interacting protein
    • WD repeat containing protein 11
    • WD repeat protein 11
    • WDR11
    see all
  • Relevance

    PHIP contains two bromo domains and eight WD repeats. It may be involved in insulin signaling. It is expressed in myeloma and epidermoid carcinoma cell lines.

Images

  • 4-20% SDS-PAGE analysis of 2.3 µg ab196110 with Coomassie staining.

References

ab196110 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab196110.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up