Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      RRFSTSVKPDVVVQVTVLAENNHIKDLLRKHGVNVQSIADIHPIQVQPGR ILSHIYAKLGRNKNMNLSGRPYRHIGVLGTSKLYVIRNQIFTFT
    • Amino acids
      428 to 521
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159109 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • dJ499B10.2 (phosphorylase kinase, alpha 2 (liver) (PYK))
    • GSD9A
    • PHK
    • PHKLA
    • Phosphorylase b kinase alpha regulatory chain, liver isoform
    • phosphorylase b kinase regulatory subunit alpha, liver isoform
    • Phosphorylase kinase , liver, alpha-2 subunit
    • Phosphorylase kinase alpha 2
    • phosphorylase kinase alpha L subunit
    • phosphorylase kinase alpha subunit
    • phosphorylase kinase deficiency, liver (glycogen storage disease type VIII
    • phosphorylase kinase deficiency, liver (glycogen storage disease)
    • phosphorylase kinase, alpha 2 (liver)
    • phosphorylase kinase, alpha 2 (liver), glycogen storage disease IX
    • PYK
    • PYKL
    • XLG
    • XLG2
    see all
  • Relevance
    PHKA2 belongs to the phosphorylase b kinase regulatory chain family. It is a polymer of 16 chains, four each of alpha, beta, gamma, and delta. Alpha and beta are regulatory chains, gamma is the catalytic chain, and delta is calmodulin. It catalyzes the phosphorylation of serine in certain substrates, including troponin I. The alpha chain may bind calmodulin.
  • Cellular localization
    Cell membrane; Lipid-anchor; Cytoplasmic side

Images

  • ab159109 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159109 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159109.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up