Description

  • Product name

    Recombinant Human PHKG2 protein
    See all PHKG2 proteins and peptides
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MTLDVGPEDELPDWAAAKEFYQKYDPKDVIGRGVSSVVRRCVHRATGHEF AVKIMEVTAERLSPEQLEEVREATRRETHILRQVAGHPHIITLIDSYESS SFMFLVFDLMRKGELFDYLTEKVALSEKETRSIMRSLLEAVSFLHANNIV HRDLKPENILLDDNMQIRLSDFGFSCHLEPGEKLRELCGTPGYLAPEILK CSMDETHPGYGKEVDLWACGVILFTLLAGSPPFWHRRQILMLRMIMEGQY QFSSPEWDDRSSTVKDLISRLLQVDPEARLTAEQALQHPFFERCEGSQPW NLTPRQRFRVAVWTVLAAGRVALSTHRVRPLTKNALLRDPYALRSVRHLI DNCAFRLYGHWVKKGEQQNRAALFQHRPPGPFPIMGPEEEGDSAAITEDE AVLVLG
    • Amino acids

      1 to 406
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159113 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • GSD9C
    • PHK gamma LT
    • PHK gamma T
    • Phosphorylase b kinase gamma catalytic chain testis/liver isoform
    • Phosphorylase b kinase gamma catalytic chain, liver/testis isoform
    • Phosphorylase kinase catalytic subunit gamma 2
    • Phosphorylase kinase gamma subunit 2
    • Phosphorylase kinase subunit gamma 2
    • Phosphorylase kinase, gamma 2 (testis)
    • Phosphorylase kinase, gamma 2 (testis/liver)
    • PSK C3
    • Serine/threonine protein kinase PHKG2
    see all
  • Relevance

    Mutations in PHKG2 along with PHKA2 and PHKB, all three different genes of phosphorylase kinase (Phk) subunits, can give rise to glycogen storage disease of the liver. The autosomal-recessive, liver-specific variant of Phk deficiency is caused by mutations in the gene encoding the testis/liver isoform of the catalytic gamma subunit, PHKG2.
  • Cellular localization

    Cytoplasmic

Images

  • ab159113 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159113 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159113.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up