Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      CVLTERGLQLFEAKGTGGRPKELSFARIKAVECVESTGRHIYFTLVTEGG GEIDFRCPLEDPGWNAQITLGLVKFKNQQAIQTVRARQSLGTGTLVS
    • Amino acids

      31 to 127
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161714 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • PHLA3_HUMAN
    • PHLDA 3
    • phlda3
    • Pleckstrin homology like domain family A member 2
    • Pleckstrin homology like domain family A member 3
    • Pleckstrin homology-like domain family A member 3
    • TDAG51/Ipl homolog 1
    • TDAG51/Ipl homologue 1
    • TIH 1
    • TIH1
    see all
  • Function

    p53/TP53-regulated repressor of Akt/AKT1 signaling. Represses AKT1 by preventing AKT1-binding to membrane lipids, thereby inhibiting AKT1 translocation to the cellular membrane and activation. Contributes to p53/TP53-dependent apoptosis by repressing AKT1 activity. Its directs transcription regulation by p53/TP53 may explain how p53/TP53 can negatively regulate AKT1. May acts as a tumor suppressor.
  • Tissue specificity

    Widely expressed with lowest expression in liver and spleen.
  • Sequence similarities

    Belongs to the PHLDA3 family.
    Contains 1 PH domain.
  • Domain

    The PH domain binds phosphoinositides with a broad specificity. It competes with the PH domain of AKT1 and directly interferes with AKT1 binding to phosphatidylinositol 4,5-bisphosphate (PIP2) and phosphatidylinositol 3,4,5-triphosphate (PIP3), preventing AKT1 association to membrane lipids and subsequent activation of AKT1 signaling.
  • Cellular localization

    Cytoplasm. Membrane.
  • Information by UniProt

Images

  • ab161714 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161714 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161714.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up