Description

  • Product name

    Recombinant Human PHOSPHO2 protein
  • Purity

    > 85 % SDS-PAGE.
    ab116206 was purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSHMKILLVFDFDNTIIDDNSDTWIVQCA PNKKLPIELRDSYRKGFWTEFMGRVFKYLGDKGVREHEMKRAVTSLPFTP GMVELFNFIRKNKDKFDCIIISDSNSVFIDWVLEAASFHDIFDKVFTNPA AFNSNGHLTVENYHTHSCNRCPKNLCKKVVLIEFVDKQLQQGVNYTQIVY IGDGGNDVCPVTFLKNDDVAMPRKGYTLQKTLSRMSQNLEPMEYSVVVWS SGVDIISHLQFLIKD
    • Predicted molecular weight

      30 kDa including tags
    • Amino acids

      1 to 241
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab116206 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.02% DTT, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names

    • EC=3.1.3.74
    • MGC111048
    • MGC22679
    • OTTHUMP00000204770
    • OTTHUMP00000204771
    • OTTHUMP00000204772
    • PHOP2_HUMAN
    • phosphatase, orphan 2
    • PHOSPHO2
    • Pyridoxal phosphate phosphatase PHOSPHO2
    see all
  • Function

    Phosphatase that has high activity toward pyridoxal 5'-phosphate (PLP). Also active at much lower level toward pyrophosphate, phosphoethanolamine (PEA), phosphocholine (PCho), phospho-l-tyrosine, fructose-6-phosphate, p-nitrophenyl phosphate, and h-glycerophosphate.
  • Sequence similarities

    Belongs to the HAD-like hydrolase superfamily. PHOSPHO family.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab116206.

References

ab116206 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116206.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up