Recombinant Human Phospholipase A2 activator protein (PLAP) (ab160457)

Overview

  • Product name
    Recombinant Human Phospholipase A2 activator protein (PLAP)
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KNIHIALATLALNYSVCFHKDHNIEGKAQCLSLISTILEVVQDLEATFRL LVALGTLISDDSNAVQLAKSLGVDSQIKKYSSVSEPAKVSECCRFILNLL
    • Amino acids
      639 to 738
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160457 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ11281
    • FLJ12699
    • Glycerophosphatase
    • OTTHUMP00000045176
    • Phospholipase A 2 activating protein
    • Phospholipase A-2-activating protein
    • Phospholipase A2 activating protein
    • PLA2P
    • Plaa
    • PLAP
    • PLAP_HUMAN
    see all
  • Function
    Involved in the maintenance of ubiquitin levels.
  • Sequence similarities
    Belongs to the WD repeat PLAP family.
    Contains 6 ARM repeats.
    Contains 1 PFU domain.
    Contains 1 PUL domain.
    Contains 7 WD repeats.
  • Domain
    The PUL domain is composed of 6 armadillo-like repeats and mediates the interaction with VCP C-terminus.
    The PFU domain mediates interaction with ubiquitin.
  • Information by UniProt

Images

  • ab160457 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160457 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160457.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up