Recombinant Human Phospholipase C gamma 1/PLC-gamma-1 protein (ab112339)
Key features and details
- Expression system: Wheat germ
- Tags: GST tag N-Terminus
- Suitable for: SDS-PAGE, ELISA, WB
Description
-
Product name
Recombinant Human Phospholipase C gamma 1/PLC-gamma-1 protein -
Expression system
Wheat germ -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
LKNNYSEDLELASLLIKIDIFPAKQENGDLSPFSGTSLRERGSDASGQLF HGRAREGSFESRYQQPFEDFRISQEHLADHFDSRERRAPRRTRVNGDNRL -
Predicted molecular weight
37 kDa including tags -
Amino acids
1192 to 1291 -
Tags
GST tag N-Terminus
-
Specifications
Our Abpromise guarantee covers the use of ab112339 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
ELISA
Western blot
-
Form
Liquid -
Additional notes
This product was previously labelled as Phospholipase C gamma 1
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 8.00
Constituents: 0.31% Glutathione, 0.79% Tris HCl
General Info
-
Alternative names
- 1 phosphatidyl D myo inositol 4 5 bisphosphate
- 1 phosphatidylinositol 4 5 bisphosphate phosphodiesterase gamma 1
- 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-1
see all -
Function
Plays a role in actin reorganization and cell migration. The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes. Major substrate for heparin-binding growth factor 1 (acidic fibroblast growth factor)-activated tyrosine kinase. -
Sequence similarities
Contains 1 C2 domain.
Contains 1 EF-hand domain.
Contains 2 PH domains.
Contains 1 PI-PLC X-box domain.
Contains 1 PI-PLC Y-box domain.
Contains 2 SH2 domains.
Contains 1 SH3 domain. -
Domain
The SH3 domain mediates interaction with CLNK (By similarity). The SH3 domain also mediates interaction with RALGPS1. -
Post-translational
modificationsThe receptor-mediated activation of PLC-gamma-1 and PLC-gamma-2 involves their phosphorylation by tyrosine kinases in response to ligation of a variety of growth factor receptors and immune system receptors. May be dephosphorylated by PTPRJ.
Ubiquitinated by CBLB in activated T-cells. -
Cellular localization
Cell projection > lamellipodium. Cell projection > ruffle. Rapidly redistributed to ruffles and lamellipodia structures in response to epidermal growth factor (EGF) treatment. - Information by UniProt
Images
-
SDS-PAGE - Recombinant Human Phospholipase C gamma 1/PLC-gamma-1 protein (ab112339)ab112339 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab112339 has not yet been referenced specifically in any publications.
