Recombinant Human Phosphoserine Aminotransferase protein (Tagged) (ab198054)

Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGL EFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVL DIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTH PDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIA WPLQGWQATFGGGDHPPKSDLEVLFQGPLGSMDAPRQVVNFGPGPAKLPH SVLLEIQKELLDYKGVGISVLEMSHRSSDFAKIINNTENLVRELLAVPDN YKVIFLQGGGCGQFSAVPLNLIGLKAGRCADYVVTGAWSAKAAEEAKKFG TINIVHPKLGSYTKIPDPSTWNLNPDASYVYYCANETVHGVEFDFIPDVK GAVLVCDMSSNFLSKPVDVSKFGVIFAGAQKNVGSAGVTVVIVRDDLLGF ALRECPSVLEYKVQAGNSSLYNTPPCFSIYVMGLVLEWIKNNGGAAAMEK LSSIKSQTIYEIIDNSQGFYVCPVEPQNRSKMNIPFRIGNAKGDDALEKR FLDKALELNMLSLKGHRSVGGIRASLYNAVTIEDVQKLAAFMKKFLEMHQ L
    • Molecular weight

      67 kDa including tags
    • Amino acids

      2 to 370
    • Tags

      GST tag N-Terminus
    • Additional sequence information

      GenBank Accession No. NM_058179

Specifications

Our Abpromise guarantee covers the use of ab198054 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    >= 76 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.49% Glutathione, 20% Glycerol, 0.04% Tween, 0.02% Potassium chloride

General Info

  • Alternative names

    • EC 2.6.1.52
    • Endometrial progesterone induced protein
    • EPIP
    • MGC1460
    • NLS2
    • Phosphohydroxythreonine aminotransferase
    • Phosphoserine aminotransferase
    • phosphoserine aminotransferase 1
    • PSA
    • PSAT
    • Psat1
    • PSATD
    • SERC_HUMAN
    see all
  • Function

    Catalyzes the reversible conversion of 3-phosphohydroxypyruvate to phosphoserine and of 3-hydroxy-2-oxo-4-phosphonooxybutanoate to phosphohydroxythreonine.
  • Tissue specificity

    Expressed at high levels in the brain, liver, kidney and pancreas, and very weakly expressed in the thymus, prostate, testis and colon.
  • Pathway

    Amino-acid biosynthesis; L-serine biosynthesis; L-serine from 3-phospho-D-glycerate: step 2/3.
    Cofactor biosynthesis; pyridoxine 5'-phosphate biosynthesis; pyridoxine 5'-phosphate from D-erythrose 4-phosphate: step 3/5.
  • Involvement in disease

    Defects in PSAT1 are the cause of phosphoserine aminotransferase deficiency (PSATD) [MIM:610992]. PSATD is characterized biochemically by low plasma and cerebrospinal fluid concentrations of serine and glycine and clinically by intractable seizures, acquired microcephaly, hypertonia, and psychomotor retardation.
  • Sequence similarities

    Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. SerC subfamily.
  • Information by UniProt

Images

  • 4-20% SDS-PAGE analysis of 3.6 µg ab198054 with Coomassie staining.

References

ab198054 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198054.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up