Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MDYSYLNSYDSCVAAMEASAYGDFGACSQPGGFQYSPLRPAFPAAGPPCP ALGSSNCALGALRDHQPAPYSAVPYKFFPEPSGLHEKRKQRRIRTTFTSA QLKELERVFAETHYPDIYTREELALKIDLTEARVQVWFQNRRAKFRKQER AASAKGAAGAAGAKKGEARCSSEDDDSKESTCSPTPDSTASLPPPPAPGL ASPRLSPSPLPVALGSGPGPGPGPQPLKGALWAGVAGGGGGGPGAGAAEL LKAWQPAESGPGPFSGVLSSFHRKPGPALKTNLF
    • Amino acids

      1 to 284
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab157905 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Aristaless homeobox (Drosophila) fibrosis of extraocular muscles congenital 2 autosomal recessive
    • Aristaless homeobox gene homolog (Drosophila)
    • Aristaless homeobox homolog
    • Aristaless homeobox protein homolog
    • ARIX
    • ARIX 1 homeodomain protein
    • Arix homeodomain protein
    • ARIX1 homeodomain protein
    • CFEOM 2
    • CFEOM2
    • FEOM 2
    • FEOM2
    • Fibrosis of extraocular muscles congenital 2 autosomal recessive
    • MGC52227
    • NCAM 2
    • NCAM2
    • Paired like (aristaless) Homeobox 2A
    • Paired like homeobox 2a
    • Paired mesoderm homeobox 2a
    • Paired mesoderm homeobox protein 2A
    • Paired-like homeobox 2A
    • PHOX 2A
    • Phox2
    • Phox2a
    • PHX2A_HUMAN
    • Pmx 2a
    • Pmx2
    • Pmx2a
    see all
  • Function

    May be involved in regulating the specificity of expression of the catecholamine biosynthetic genes. Acts as a transcription activator/factor. Could maintain the noradrenergic phenotype.
  • Involvement in disease

    Defects in PHOX2A are the cause of congenital fibrosis of extraocular muscles type 2 (CFEOM2) [MIM:602078]. CFEOM encompasses several different inherited strabismus syndromes characterized by congenital restrictive ophthalmoplegia affecting extraocular muscles innervated by the oculomotor and/or trochlear nerves. CFEOM is characterized clinically by anchoring of the eyes in downward gaze, ptosis, and backward tilt of the head. CFEOM2 may result from the aberrant development of the oculomotor (nIII), trochlear (nIV) and abducens (nVI) cranial nerve nuclei.
  • Sequence similarities

    Belongs to the paired homeobox family.
    Contains 1 homeobox DNA-binding domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab157905 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab157905 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157905.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up