Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDYSYLNSYDSCVAAMEASAYGDFGACSQPGGFQYSPLRPAFPAAGPPCP ALGSSNCALGALRDHQPAPYSAVPYKFFPEPSGLHEKRKQ
    • Amino acids
      1 to 90
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab157906 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Aristaless homeobox (Drosophila) fibrosis of extraocular muscles congenital 2 autosomal recessive
    • Aristaless homeobox gene homolog (Drosophila)
    • Aristaless homeobox homolog
    • Aristaless homeobox protein homolog
    • ARIX
    • ARIX 1 homeodomain protein
    • Arix homeodomain protein
    • ARIX1 homeodomain protein
    • CFEOM 2
    • CFEOM2
    • FEOM 2
    • FEOM2
    • Fibrosis of extraocular muscles congenital 2 autosomal recessive
    • MGC52227
    • NCAM 2
    • NCAM2
    • Paired like (aristaless) Homeobox 2A
    • Paired like homeobox 2a
    • Paired mesoderm homeobox 2a
    • Paired mesoderm homeobox protein 2A
    • Paired-like homeobox 2A
    • PHOX 2A
    • Phox2
    • Phox2a
    • PHX2A_HUMAN
    • Pmx 2a
    • Pmx2
    • Pmx2a
    see all
  • Function
    May be involved in regulating the specificity of expression of the catecholamine biosynthetic genes. Acts as a transcription activator/factor. Could maintain the noradrenergic phenotype.
  • Involvement in disease
    Defects in PHOX2A are the cause of congenital fibrosis of extraocular muscles type 2 (CFEOM2) [MIM:602078]. CFEOM encompasses several different inherited strabismus syndromes characterized by congenital restrictive ophthalmoplegia affecting extraocular muscles innervated by the oculomotor and/or trochlear nerves. CFEOM is characterized clinically by anchoring of the eyes in downward gaze, ptosis, and backward tilt of the head. CFEOM2 may result from the aberrant development of the oculomotor (nIII), trochlear (nIV) and abducens (nVI) cranial nerve nuclei.
  • Sequence similarities
    Belongs to the paired homeobox family.
    Contains 1 homeobox DNA-binding domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab157906 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab157906 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157906.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up