Description

  • Product name

    Recombinant Human PHPT1 protein
  • Purity

    > 95 % SDS-PAGE.
    ab99865 is purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMAVADLALIPDVDIDSDGVFKYVLIRVHSA PRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRIS HQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGY
    • Predicted molecular weight

      16 kDa
    • Amino acids

      1 to 125
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99865 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.0308% DTT, 0.316% Tris HCl, 10% Glycerol, 1.16% Sodium chloride

General Info

  • Alternative names

    • 14 kDa phosphohistidine phosphatase
    • CGI 202
    • HSPC141
    • Phosphohistidine phosphatase 1
    • PHP14
    • PHP14_HUMAN
    • PHPT1
    • Protein janus A homolog
    • Protein janus-A homolog
    • Sex regulated protein janus a
    see all
  • Function

    Exhibits phosphohistidine phosphatase activity.
  • Tissue specificity

    Expressed abundantly in heart and skeletal muscle.
  • Sequence similarities

    Belongs to the janus family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab99865 (3µg).

References

ab99865 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab99865.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up