Description

  • Product name

    Recombinant Human PI-15 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MIAISAVSSALLFSLLCEASTVVLLNSTDSSPPTNNFTDIEAALKAQLDS ADIPKARRKRYISQNDMIAILDYHNQVRGKVFPPAANMEYMVWDENLAKS AEAWAATCIWDHGPSYLLRFLGQNLSVRTGRYRSILQLVKPWYDEVKDYA FPYPQDCNPRCPMRCFGPMCTHYTQMVWATSNRIGCAIHTCQNMNVWGSV WRRAVYLVCNYAPKGNWIGEAPYKVGVPCSSCPPSYGGSCTDNLCFPGVT SNYLYWFK
    • Predicted molecular weight

      56 kDa including tags
    • Amino acids

      1 to 258

Associated products

Specifications

Our Abpromise guarantee covers the use of ab131953 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
    Best use within three months from the date of receipt of this protein.

    Previously labelled as Protease Inhibitor 15. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 25 kDa trypsin inhibitor
    • CRISP-8
    • CRISP8
    • Cysteine rich secretory protein 8
    • Cysteine-rich secretory protein 8
    • P24TI
    • p25TI
    • Peptidase inhibitor 15
    • PI-15
    • PI15
    • PI15_HUMAN
    • Protease Inhibitor 15
    • SugarCrisp
    see all
  • Function

    Serine protease inhibitor which displays weak inhibitory activity against trypsin.
  • Tissue specificity

    Weakly expressed. Expressed at low level in prostate, mammary gland, salivary gland and thyroid gland.
  • Sequence similarities

    Belongs to the CRISP family.
  • Post-translational
    modifications

    N-glycosylated.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE Stained with Coomassie Blue showing ab131953.

References

ab131953 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131953.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up