Recombinant human PI 3 Kinase p110 alpha + PI 3 kinase p85 alpha (mutated N345 K) protein (ab204094)

Description

  • Product name

    Recombinant human PI 3 Kinase p110 alpha + PI 3 kinase p85 alpha (mutated N345 K) protein
    See all PI 3 Kinase p110 alpha + PI 3 kinase p85 alpha proteins and peptides
  • Biological activity

    The specific activity of ab204094 was determined to be 18 nmol/min/mg.

  • Purity

    > 80 % Densitometry.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Amino Acid Sequence 1

    • Species

      Human
    • Sequence

      MSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARP EEIGWLNGYNETTGERGDFPGTYVEYIGRKKISPPTPKPRPPRPLPVAPG SSKTEADVEQQALTLPDLAEQFAPPDIAPPLLIKLVEAIEKKGLECSTLY RTQSSSNLAELRQLLDCDTPSVDLEMIDVHVLADAFKRYLLDLPNPVIPA AVYSEMISLAPEVQSSEEYIQLLKKLIRSPSIPHQYWLTLQYLLKHFFKL SQTSSKNLLNARVLSEIFSPMLFRFSAASSDNTENLIKVIEILISTEWNE RQPAPALPPKPPKPTTVANNGMNNNMSLQDAEWYWGDISREEVNEKLRDT ADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFSS VVELINHYRNESLAQYNPKLDVKLLYPVSKYQQDQVVKEDNIEAVGKKLH EYNTQFQEKSREYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCQT QERYSKEYIEKFKREGNEKEIQRIMHNYDKLKSRISEIIDSRRRLEEDLK KQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGN ENTEDQYSLVEDDEDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRE SSKQGCYACSVVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQH TSLVQHNDSLNVTLAYPVYAQQRR
    • Predicted molecular weight

      86 kDa including tags
    • Amino acids

      1 to 724
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NM_181523.2.
    • Amino Acid Sequence 2

    • Species

      Human
    • Sequence

      MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLITIKHELF KEARKYPLHQLLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLK VIEPVGNREEKILNREIGFAIGMPVCEFDMVKDPEVQDFRRNILNVCKEA VDLRDLNSPHSRAMYVYPPNVESSPELPKHIYNKLDKGQIIVVIWVIVSP NNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLKLCVLEYQGKY ILKVCGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYSQLPMD CFTMPSYSRRISTATPYMNGETSTKSLWVINSALRIKILCATYVKVNIRD IDKIYVRTGIYHGGEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAA RLCLSICSVKGRKGAKEEHCPLAWGNINLFDYTDTLVSGKMALNLWPVPH GLEDLLNPIGVTGSNPNKETPCLELEFDWFSSVVKFPDMSVIEEHANWSV SREAGFSYSHAGLSNRLARDNELRENDKEQLKAISTRDPLSEITEQEKDF LWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAME LLDCNYPDPMVRGFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLV RFLLKKALTNQRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLK HLNRQVEAMEKLINLTDILKQEKKDETQKVQMKFLVEQMRRPDFMDALQG FLSPLNPAHQLGNLRLEECRIMSSAKRPLWLNWENPDIMSELLFQNNEII FKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLSIGDCVGLIEV VRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEIYDAAIDLFTRS CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRE RVPFVLTQDFLIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFIN LFSMMLGSGMPELQSFDDIAYIRKTLALDKTEQEALEYFMKQMNDAHHGG WTTKMDWIFHTIKQHALN
    • Predicted molecular weight

      111 kDa including tags
    • Amino acids

      1 to 1068
    • Modifications

      mutated N345 K
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NM_006218.

Specifications

Our Abpromise guarantee covers the use of ab204094 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7
    Preservative: 1.02% Imidazole
    Constituents: 0.82% Sodium phosphate, 1.74% Sodium chloride, 0.002% PMSF, 0.004% DTT, 25% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • GRB1
    • MGC142161
    • MGC142163
    • p110 alpha
    • p85
    • p85 alpha
    • Phosphatidylinositol 3 kinase 85 kDa regulatory subunit alpha
    • Phosphatidylinositol 3 kinase associated p 85 alpha
    • Phosphatidylinositol 3 kinase catalytic 110 KD alpha
    • Phosphatidylinositol 3 kinase catalytic alpha polypeptide
    • Phosphatidylinositol 3 kinase regulatory 1
    • Phosphatidylinositol 3 kinase regulatory subunit alpha
    • Phosphatidylinositol 3 kinase regulatory subunit polypeptide 1
    • Phosphatidylinositol 4 5 bisphosphate 3 kinase 110 kDa catalytic subunit alpha
    • Phosphatidylinositol 4 5 bisphosphate 3 kinase catalytic subunit alpha isoform
    • Phosphoinositide 3 kinase catalytic alpha polypeptide
    • Phosphoinositide 3 kinase regulatory subunit 1
    • Phosphoinositide 3 kinase regulatory subunit 1 (alpha)
    • PI3 kinase p110 subunit alpha
    • PI3 kinase regulatory subunit alpha
    • PI3 kinase subunit alpha
    • PI3 kinase subunit p85 alpha
    • PI3K
    • PI3K alpha
    • PI3K regulatory subunit alpha
    • PIK3CA
    • PIK3R1
    • PtdIns 3 kinase p110
    • PtdIns 3 kinase regulatory subunit alpha
    • PtdIns 3 kinase regulatory subunit p85 alpha
    • PtdIns 3 kinase subunit alpha
    • PtdIns 3 kinase subunit p110 alpha
    see all
  • Relevance

    Phosphoinositide 3-kinases (PI3Ks) phosphorylate phosphatidylinositols (PIs) at their 3´ OH position generating lipid second messengers and thereby regulate numerous biological processes including cell growth, differentiation, survival, proliferation, migration and metabolism. On the basis of structural similarities and substrate specificity, the PI3K family can be subdivided into three classes termed I, II, and III. All human class I members are heterodimers consisting of a catalytic subunit (MW approx. 110 kDa) and a non-catalytic subunit (MW 50, 55, 85, or 101 kDa) and are known to phosphorylate phosphatidylinositol (PI), phosphatidylinositol-4-mono-phosphate (PIP) and phosphatidylinositol-4,5-bisphosphate (PIP2) in vitro. The class I members can be further subdivided into class IA and IB PI3Ks. Class IA exists in three isoforms (p110alpha, p110beta and p110delta whereas the only class IB member is termed p110gamma. Class IA PI3Ks are activated by adaptor proteins such as Ras or BCAP, or tyrosine-kinase-associated receptors including antigen, co-stimulatory and cytokine receptors (e.g. CD19, CD28, Insulin receptor, EGFR, and PDGFR). p110gamma is activated by G-protein-coupled receptors (GPCRs). Effectors of class I PI3Ks are pleckstrin homology domain proteins such as Akt/PKB, BTK, TEC, ITK, BAM32, and small GTPases (e.g. Cdc42, Rac, or Ras). The action of PI3Ks is regulated by the phosphatidylinositol- 3,4,5-trisphosphate phosphatases SHIP and PTEN.

Images

  • The purity of ab204094 was determined to be >80% by densitometry.

  • Kinase assay showing the specific activity of ab204094 as 18 nmol/min/mg.

References

ab204094 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204094.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up