Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MYNTVWSMDRDDADWREVMMPYSTELIFYIEMDPPALPPKPPKPMTSAVP NGMKDSSVSLQDAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKMQGDY TLTLRKGGNNKLIKIYHRDGKYGFSDPLTFNSVVELINHYHHESLAQYNP KLDVKLMYPVSRYQQDQLVKEDNIDAVGKKLQEYHSQYQEKSKEYDRLYE EYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQHSKEYIERFRREGNE KEIERIMMNYDKLKSRLGEIHDSKMRLEQDLKNQALDNREIDKKMNSIKP DLIQLRKIRDQHLVWLNHKGVRQKRLNVWLGIKNEDAAENYFINEEDENL PHYDEKTWFVEDINRVQAEDLLYGKPDGAFLIRESSKKGCYACSVVADGE VKHCVIYSTARGYGFAEPYNLYSSLKELVLHYQQTSLVQHNDSLNVRLAY PVHAQMPSLCR
    • Amino acids
      1 to 461
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160059 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp686P05226
    • FLJ41892
    • OTTHUMP00000009783
    • OTTHUMP00000009786
    • p55
    • p55 gamma
    • P55G_HUMAN
    • p55PIK
    • Phosphatidylinositol 3 kinase regulatory subunit gamma
    • Phosphatidylinositol 3 kinase regulatory subunit polypeptide 3
    • Phosphatidylinositol 3 kinase, regulatory subunit, polypeptide 3 (p55, gamma)
    • Phosphatidylinositol 3-kinase 55 kDa regulatory subunit gamma
    • Phosphatidylinositol 3-kinase regulatory subunit gamma
    • Phosphoinositide 3 kinase regulatory subunit 3
    • Phosphoinositide 3 kinase regulatory subunit 3 (gamma)
    • Phosphoinositide 3 kinase regulatory subunit polypeptide 3
    • Phosphoinositide 3 kinase, regulatory subunit 3 (p55, gamma)
    • Phosphoinositide 3 kinase, regulatory subunit, polypeptide 3 (p55, gamma)
    • PI3 kinase p85 subunit gamma
    • PI3-kinase regulatory subunit gamma
    • PI3-kinase subunit p55-gamma
    • PI3K regulatory subunit gamma
    • Pik3r3
    • PtdIns 3 kinase p85 gamma
    • PtdIns-3-kinase regulatory subunit gamma
    • PtdIns-3-kinase regulatory subunit p55-gamma
    see all
  • Function
    Binds to activated (phosphorylated) protein-tyrosine kinases through its SH2 domain and regulates their kinase activity. During insulin stimulation, it also binds to IRS-1.
  • Tissue specificity
    Highest levels in brain and testis. Lower levels in adipose tissue, kidney, heart, lung and skeletal muscle.
  • Sequence similarities
    Belongs to the PI3K p85 subunit family.
    Contains 2 SH2 domains.
  • Information by UniProt

Images

  • ab160059 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160059 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160059.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up