Description

  • Product name

    Recombinant Human PI 3 Kinase p85 alpha protein
    See all PI 3 Kinase p85 alpha proteins and peptides
  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARP EEIGWLNGYN ETTGERGDFPGTYVEYIGRKKISPPTPKPRPPRPLPVA PGSSKTEADVEQQALTLPDLAE QFAPPDIAPPLLIKLVEAIEKKGLEC STLYRTQSSSNLAELRQLLDCDTPSVDLEMIDVH VLADAFKRYLLDLP NPVIPAAVYSEMISLAPEVQSSEEYIQLLKKLIRSPSIPHQYWLTL QY LLKHFFKLSQTSSKNLLNARVLSEIFSPMLFRFSAASSDNTENLIKVIEI LISTEWNE RQPAPALPPKPPKPTTVANNGMNNNMSLQDAEWYWGDISR EEVNEKLRDTADGTFLVRDA STKMHGDYTLTLRKGGNNKLIKIFHRDG KYGFSDPLTFSSVVELINHYRNESLAQYNPKL DVKLLYPVSKYQQDQV VKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEEYTRTSQEIQMK RTAI EAFNETIKIFEEQCQTQERYSKEYIEKFKREGNEKEIQRIMHNYDKLKSR ISEIID SRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLM WLTQKGVRQKKLNEWLGN ENTEDQYSLVEDDEDLPHHDEKTWNVGSSN RNKAENLLRGKRDGTFLVRESSKQGCYACS VVVDGEVKHCVINKTATG YGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPVYA QQRR
    • Amino acids

      1 to 724
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab84769 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 7.00
    Preservative: 1.02% Imidazole
    Constituents: 0.00174% PMSF, 0.82% Sodium phosphate, 0.0308% DTT, 25% Glycerol, 1.74% Sodium chloride

General Info

  • Alternative names

    • GRB1
    • p85
    • p85 alpha
    • P85A_HUMAN
    • Phosphatidylinositol 3 kinase associated p 85 alpha
    • Phosphatidylinositol 3 kinase regulatory 1
    • Phosphatidylinositol 3 kinase, regulatory subunit, polypeptide 1 (p85 alpha)
    • Phosphatidylinositol 3-kinase 85 kDa regulatory subunit alpha
    • Phosphatidylinositol 3-kinase regulatory subunit alpha
    • Phosphoinositide 3 kinase, regulatory subunit 1 (alpha)
    • PI3 kinase p85
    • PI3 kinase p85 subunit alpha
    • PI3-kinase regulatory subunit alpha
    • PI3-kinase subunit p85-alpha
    • PI3K
    • PI3K p85
    • PI3K regulatory subunit alpha
    • Pik3r1
    • PtdIns 3 kinase p85 alpha
    • PtdIns-3-kinase regulatory subunit alpha
    • PtdIns-3-kinase regulatory subunit p85-alpha
    see all
  • Function

    Binds to activated (phosphorylated) protein-Tyr kinases, through its SH2 domain, and acts as an adapter, mediating the association of the p110 catalytic unit to the plasma membrane. Necessary for the insulin-stimulated increase in glucose uptake and glycogen synthesis in insulin-sensitive tissues.
  • Tissue specificity

    Isoform 2 is expressed in skeletal muscle and brain, and at lower levels in kidney and cardiac muscle. Isoform 2 and isoform 4 are present in skeletal muscle (at protein level).
  • Sequence similarities

    Belongs to the PI3K p85 subunit family.
    Contains 1 Rho-GAP domain.
    Contains 2 SH2 domains.
    Contains 1 SH3 domain.
  • Domain

    The SH3 domain mediates the binding to CBLB, and to HIV-1 Nef.
  • Post-translational
    modifications

    Polyubiquitinated in T-cells by CBLB; which does not promote proteasomal degradation but impairs association with CD28 and CD3Z upon T-cell activation.
    Phosphorylated. Dephosphorylated by PTPRJ.
  • Information by UniProt

Images

  • SDS-PAGE showing ab84769 at approximately 86kDa.

References

ab84769 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Answer

Thank you for contacting us.

Please find attached the answers in the attached document.

I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up