Recombinant Human PI3 Kinase p110 beta protein (ab159128)

Overview

  • Product name
    Recombinant Human PI3 Kinase p110 beta protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      EFRRKMRKFSEEKILSLVGLSWMDWLKQTYPPEHEPSIPENLEDKLYGGK LIVAVHFENCQDVFSFQVSPNMNPIKVNELAIQKRLTIHGKEDEVSPYDY VLQVSGRVEY
    • Amino acids
      147 to 256
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159128 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 5-bisphosphate 3-kinase 110 kDa catalytic subunit beta
    • 5-bisphosphate 3-kinase catalytic subunit beta isoform
    • DKFZp779K1237
    • MGC133043
    • OTTHUMP00000216901
    • OTTHUMP00000216904
    • p110 BETA
    • p110Beta
    • Phosphatidylinositol 3 kinase catalytic beta polypeptide
    • Phosphatidylinositol 4 5 bisphosphate 3 kinase 110 kDa catalytic subunit beta
    • Phosphatidylinositol 4 5 bisphosphate 3 kinase catalytic subunit beta isoform
    • Phosphatidylinositol-4
    • Phosphoinositide 3 kinase catalytic beta polypeptide
    • PI3 kinase p110 subunit beta
    • PI3-kinase subunit beta
    • PI3K
    • PI3K beta
    • PI3K-beta
    • PI3Kbeta
    • PI3KCB
    • PIK3C1
    • Pik3cb
    • PK3CB_HUMAN
    • PtdIns 3 kinase p110
    • PtdIns-3-kinase subunit beta
    • PtdIns-3-kinase subunit p110-beta
    see all
  • Function
    Phosphorylates PtdIns, PtdIns4P and PtdIns(4,5)P2 with a preference for PtdIns(4,5)P2.
  • Tissue specificity
    Expressed ubiquitously.
  • Pathway
    Phospholipid metabolism; phosphatidylinositol phosphate biosynthesis.
  • Sequence similarities
    Belongs to the PI3/PI4-kinase family.
    Contains 1 PI3K/PI4K domain.
  • Information by UniProt

Images

  • ab159128 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159128 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159128.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up