Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      CPVCDKKAAYESLILDGLFMEILNDCSDVDEIKFQEDGSWCPMRPKKEAM KVSSQPCTKIESSSVLSKPCSVTVASEASKKKVDVIDLT
    • Amino acids
      385 to 473
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160322 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Androgen receptor interacting protein 3
    • Androgen receptor-interacting protein 3
    • ARIP3
    • DAB2 interacting protein
    • DAB2-interacting protein
    • DIP
    • E3 SUMO protein ligase PIAS2
    • E3 SUMO-protein ligase PIAS2
    • MIZ
    • Miz1
    • Msx interacting zinc finger protein
    • Msx-interacting zinc finger protein
    • PIAS NY protein
    • PIAS-NY protein
    • PIAS2
    • PIAS2_HUMAN
    • PIASX
    • PIASX-ALPHA
    • PIASX-BETA
    • Protein inhibitor of activated STAT x
    • Protein inhibitor of activated STAT, 2
    • Protein inhibitor of activated STAT2
    • SIZ2
    • Zinc finger, MIZ-type containing 4
    • ZMIZ4
    see all
  • Function
    Functions as an E3-type small ubiquitin-like modifier (SUMO) ligase, stabilizing the interaction between UBE2I and the substrate, and as a SUMO-tethering factor. Plays a crucial role as a transcriptional coregulator in various cellular pathways, including the STAT pathway, the p53 pathway and the steroid hormone signaling pathway. The effects of this transcriptional coregulation, transactivation or silencing may vary depending upon the biological context and the PIAS2 isoform studied. However, it seems to be mostly involved in gene silencing. Binds to sumoylated ELK1 and enhances its transcriptional activity by preventing recruitment of HDAC2 by ELK1, thus reversing SUMO-mediated repression of ELK1 transactivation activity. Isoform PIAS2-beta, but not isoform PIAS2-alpha, promotes MDM2 sumoylation. Isoform PIAS2-alpha promotes PARK7 sumoylation. Isoform PIAS2-beta promotes NCOA2 sumoylation more efficiently than isoform PIAS2-alpha. Isoform PIAS2-alpha sumoylates PML at'Lys-65' and 'Lys-160'.
  • Tissue specificity
    Mainly expressed in testis. Isoform 3 is expressed predominantly in adult testis, weakly in pancreas, embryonic testis and sperm, and at very low levels in other organs.
  • Pathway
    Protein modification; protein sumoylation.
  • Sequence similarities
    Belongs to the PIAS family.
    Contains 1 PINIT domain.
    Contains 1 SAP domain.
    Contains 1 SP-RING-type zinc finger.
  • Developmental stage
    Isoform 3 expression in adult testis is 14.2-fold stronger than in embryonic testis.
  • Domain
    The LXXLL motif is a transcriptional coregulator signature.
  • Post-translational
    modifications
    Sumoylated.
  • Cellular localization
    Nucleus speckle. Nucleus, PML body. Nucleus. Colocalizes at least partially with promyelocytic leukemia nuclear bodies (PML NBs) (PubMed:22406621). Colocalizes with SUMO1 in nuclear granules (By similarity).
  • Information by UniProt

Images

  • ab160322 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160322 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160322.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up