Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MFADLDYDIEEDKLGIPTVPGKVTLQKDAQNLIGISIGGGAQYCPCLYIV QVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIH YNKLQADPKQGMSLDIVLKKVKHRLVENMSSGTADALGLSRAILCNDGLV KRLEELERTAELYKGMTEHTKNLLRAFYELSQTHRAFGDVFSVIGVREPQ PAASEAFVKFADAHRSIEKFGIRLLKTIKPMLTDLNTYLNKAIPDTRLTI KKYLDVKFEYLSYCLKVKEMDDEEYSCIALGEPLYRVSTGNYEYRLILRC RQEARARFSQMRKDVLEKMELLDQKHVQDIVFQLQRLVSTMSKYYNDCYA VLRDADVFPIEVDLAHTTLAYGLNQEEFTDGEEEEEEEDTAAGEPSRDTR GAAGPLDKGGSWCDS
    • Molecular weight

      73 kDa including tags
    • Amino acids

      1 to 415

Specifications

Our Abpromise guarantee covers the use of ab131893 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • dJ1039K5
    • MGC15204
    • OTTHUMP00000028509
    • PICK 1
    • Pick1
    • PICK1_HUMAN
    • PRKCA binding protein
    • PRKCA-binding protein
    • PRKCABP
    • Protein interacting with C kinase 1
    • Protein interacting with PRKCA
    • Protein interacting with PRKCA 1
    • Protein kinase C alpha binding protein
    • Protein kinase C-alpha-binding protein
    • Protein that interacts with C kinase 1
    see all
  • Function

    Probable adapter protein that bind to and organize the subcellular localization of a variety of membrane proteins containing some PDZ recognition sequence. Involved in the clustering of various receptors, possibly by acting at the receptor internalization level. Plays a role in synaptic plasticity by regulating the trafficking and internalization of AMPA receptors. May be regulated upon PRKCA activation. May regulate heteromeric ACCN3/ACCN2 channel.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Contains 1 AH domain.
    Contains 1 PDZ (DHR) domain.
  • Post-translational
    modifications

    Phosphorylation at Thr-82 appears to inhibit the interaction with AMPA receptors.
  • Cellular localization

    Cytoplasm > perinuclear region. Cell junction > synapse. Also present at excitatory synapses.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab131893 stained with Coomassie Blue.

References

ab131893 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131893.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up