Recombinant Human PIGA protein (ab159119)
- Datasheet
- References
- Protocols
Description
-
Product name
Recombinant Human PIGA protein -
Expression system
Wheat germ -
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
LRAALNPEIVSVIPNAVDPTDFTPDPFRRHDSITIVVVSRLVYRKGIDLL SGIIPELCQKYPDLNFIIGGEGPKRIILEEVRERYQLHDRVRLLGALEHK -
Amino acids
194 to 293 -
Tags
GST tag N-Terminus
-
Specifications
Our Abpromise guarantee covers the use of ab159119 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Western blot
ELISA
-
Form
Liquid -
Additional notes
Protein concentration is above or equal to 0.05 mg/ml. -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 8.00
Constituents: 0.31% Glutathione, 0.79% Tris HCl
General Info
-
Alternative names
- Class A GlcNAc inositol phospholipid assembly protein
- GlcNAc PI synthesis protein
- GlcNAc-PI synthesis protein
see all -
Function
Necessary for the synthesis of N-acetylglucosaminyl-phosphatidylinositol, the very early intermediate in GPI-anchor biosynthesis. -
Pathway
Glycolipid biosynthesis; glycosylphosphatidylinositol-anchor biosynthesis. -
Involvement in disease
Paroxysmal nocturnal hemoglobinuria (PNH) [MIM:300818]: A disorder characterized by hemolytic anemia with hemoglobinuria, thromboses in large vessels, and a deficiency in hematopoiesis. Clinical manifestation of red blood cell breakdown with release of hemoglobin into the urine is manifested most prominently by dark-colored urine in the morning. Note=The disease is caused by mutations affecting the gene represented in this entry.
Multiple congenital anomalies-hypotonia-seizures syndrome 2 (MCAHS2) [MIM:300868]: An X-linked recessive developmental disorder characterized by dysmorphic features, neonatal hypotonia, myoclonic seizures, and variable congenital anomalies involving the central nervous, cardiac, and urinary systems. Most affected individuals die in infancy. Note=The disease is caused by mutations affecting the gene represented in this entry. -
Sequence similarities
Belongs to the glycosyltransferase group 1 family. Glycosyltransferase 4 subfamily. -
Cellular localization
Endoplasmic reticulum membrane. - Information by UniProt
Images
Datasheets and documents
References
ab159119 has not yet been referenced specifically in any publications.