Description

  • Product name

    Recombinant Human PIGP protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MVENSPSPLPERAIYGFVLFLSSQFGFILYLVWAFIPESWLNSLGLTYWP QKYWAVALPVYLLIAIVIGYVLLFGINMMSTSPLDSIHTITDNYAKNQQQ KKYQEEAIPALRDISISEVNQMFFLAAKELYTKN
    • Amino acids

      1 to 134
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162464 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • DCRC
    • DCRC S
    • Down syndrome critical region gene 5
    • Down syndrome critical region protein 5
    • Down syndrome critical region protein C
    • DSCR 5
    • DSCR5
    • DSCRC
    • DSRC
    • Phosphatidylinositol glycan anchor biosynthesis class P
    • Phosphatidylinositol glycan biosynthesis class P
    • Phosphatidylinositol glycan biosynthesis class P protein
    • Phosphatidylinositol glycan class P
    • Phosphatidylinositol n acetylglucosaminyltranferase subunit
    • Phosphatidylinositol N acetylglucosaminyltransferase subunit P
    • Phosphatidylinositol N-acetylglucosaminyltransferase subunit P
    • Phosphatidylinositol-glycan biosynthesis class P protein
    • PIG-P
    • PIGP
    • PIGP_HUMAN
    see all
  • Function

    Part of the complex catalyzing the transfer of N-acetylglucosamine from UDP-N-acetylglucosamine to phosphatidylinositol, the first step of GPI biosynthesis.
  • Tissue specificity

    Ubiquitous.
  • Pathway

    Glycolipid biosynthesis; glycosylphosphatidylinositol-anchor biosynthesis.
  • Sequence similarities

    Belongs to the PIGP family.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • ab162464 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162464 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162464.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up