Description

  • Product name

    Recombinant Human PIGQ protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MVLKAFFPTCCVSTDSGLLVGRWVPEQSSAVVLAVLHFPFIPIQVKQLLA QVRQASQVGVAVLGTWCHCRQEPEESLGRFLESLGAVFPHEPWLRLCRER GGTFWSCEATHRQAPTAPGAPGEDQVMLIFYDQRQVLLSQLHLPTVLPDR QAGATTASTGGLAAVFDTVARSEVLFRSDRFDEGPVRLSHWQSEGVEASI LAELARRASGPICLLLASLLSLVSAVSACRVFKLWPLSFLGSKLSTCEQL RHRLEHLTLIFSTRKAENPAQLMRKANTVASVLLDVALGLMLLSWLHGRS RIGHLADALVPVADHVAEELQHLLQWLMGAPAGLKMNRALDQVLGRFFLY HIHLWISYIHLMSPFVEHILWHVGLSACLGLTVALSLLSDIIALLTFHIY CFYVYGARLYCLKIHGLSSLWRLFRGKKWNVLRQRVDSCSYDLDQLFIGT LLFTILLFLLPTTALYYLVFTLLRLLVVAVQGLIHLLVDLINSLPLYSLG LRLCRPYRLADKPTALQPRGAHLPPPQLWLPPQALLGRPVPQAVPWGAHL PLEAERGQAGLRELLARLAPPHGHSQPSALPGWHQLSWRMSCALWTLLCA PEHGRPCYHTLGLEVIGSEQMWGWPARLAALHHWHCLPWDPLPTCCGHHG GEHSNPRCPEHCPMPTLCTQVQRVRPPQQPQVEGWSPWGLPSGSALAVGV EGPCQDEPPSPRHPLAPSAEQHPASGGLKQSLTPVPSGPGPSLPEPHGVY LRMFPGEVAL
    • Amino acids

      1 to 760
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160332 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Phosphatidylinositol glycan, class Q
    • c407A10.1
    • GPI1
    • hGPI1
    • MGC12693
    • N-acetylglucosamyl transferase component GPI1
    • Phosphatidylinositol glycan anchor biosynthesis, class Q
    • Phosphatidylinositol N acetylglucosaminyltransferase subunit Q
    • Phosphatidylinositol N-acetylglucosaminyltransferase subunit Q
    • Phosphatidylinositol-glycan biosynthesis class Q protein
    • PIG Q
    • PIG-Q
    • PIGQ
    • PIGQ_HUMAN
    see all
  • Function

    Part of the complex catalyzing the transfer of N-acetylglucosamine from UDP-N-acetylglucosamine to phosphatidylinositol, the first step of GPI biosynthesis.
  • Pathway

    Glycolipid biosynthesis; glycosylphosphatidylinositol-anchor biosynthesis.
  • Sequence similarities

    Belongs to the PIGQ family.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • ab160332 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160332 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160332.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up