Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      PIFGPEEVNSVEGNSVSITCYYPPTSVNRHTRKYWCRQGARGGCITLISS EGYVSSKYAGRANLTNFPENGTFVVNIAQLSQDDSGRYKCGLGINSRGLS FDVSLEVSQG
    • Amino acids
      21 to 130
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159124 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Hepatocellular carcinoma associated protein TB6
    • Hepatocellular carcinoma-associated protein TB6
    • MGC125361
    • MGC125362
    • Phosphatidylinositol glycan, class R
    • PIGR
    • PIGR_HUMAN
    • Poly Ig receptor
    • Poly-Ig receptor
    • Polymeric immunoglobulin receptor
    • Secretory component
    • Transmembrane secretory component
    see all
  • Function
    This receptor binds polymeric IgA and IgM at the basolateral surface of epithelial cells. The complex is then transported across the cell to be secreted at the apical surface. During this process a cleavage occurs that separates the extracellular (known as the secretory component) from the transmembrane segment.
  • Sequence similarities
    Contains 5 Ig-like V-type (immunoglobulin-like) domains.
  • Post-translational
    modifications
    N-glycosylation is not necessary for Ig binding.
  • Cellular localization
    Secreted and Cell membrane.
  • Information by UniProt

Images

  • ab159124 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159124 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159124.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up