Overview

  • Product name

    Recombinant Human PIGX protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MCSEIILRQEVLKDGFHRDLLIKVKFGESIEDLHTCRLLIKQDIPAGLYV DPYELASLRERNITEAVMVSENFDIEAPNYLSKESEVLIYARRDSQCIDC FQAFLPVHCRYHRPHSEDGEASIVVNNPDLLMFCDQEFPILKCWAHSEVA APCALDNEDICQWNKMKYKSVYKNVILQVPVGLTVHTSLVCSVTLLITIL CSTLILVAVFKYGHFSL
    • Amino acids

      1 to 217
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162918 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • GPI mannosyltransferase subunit
    • Phosphatidylinositol glycan class X
    • Phosphatidylinositol-glycan biosynthesis class X protein
    • PIG-X
    • Pigx
    • PIGX_HUMAN
    see all
  • Function

    Essential component of glycosylphosphatidylinositol-mannosyltransferase 1 which transfers the first of the 4 mannoses in the GPI-anchor precursors during GPI-anchor biosynthesis. Probably acts by stabilizing the mannosyltransferase PIGM.
  • Pathway

    Glycolipid biosynthesis; glycosylphosphatidylinositol-anchor biosynthesis.
  • Sequence similarities

    Belongs to the PIGX family.
  • Post-translational
    modifications

    N-glycosylated.
  • Cellular localization

    Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • ab162918 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162918 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162918.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up