Overview

  • Product name
    Recombinant Human PIK3C2B protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSSTQDNGEHWKSLESVGISRKELAMAEALQMEYDALSRLRHDKEENRAK QNADPSLISWDEPGVDFYSKPAGRRTDLKLLRGLSGSDPTLNYNSLSPQE GPPNHSTSQG
    • Amino acids
      1 to 110
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159125 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C2 PI3K
    • phosphatidylinositol 3-kinase C2 domain-containing beta polypeptide
    • phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta
    • phosphatidylinositol-4-phosphate 3-kinase, catalytic subunit type 2 beta
    • Phosphoinositide 3 Kinase C2 beta
    • Phosphoinositide 3-Kinase class 2, beta
    • phosphoinositide-3-kinase, class 2, beta polypeptide
    • PI3K C2beta
    • PtdIns 3 kinase C2 beta
    • PTDINS-3-kinase C2 beta
    • ptdIns-3-kinase C2 subunit beta
    see all
  • Relevance
    The protein encoded by this gene belongs to the phosphoinositide 3-kinase (PI3K) family. PI3-kinases play roles in signaling pathways involved in cell proliferation, oncogenic transformation, cell survival, cell migration, and intracellular protein trafficking. This protein contains a lipid kinase catalytic domain as well as a C-terminal C2 domain, a characteristic of class II PI3-kinases. C2 domains act as calcium-dependent phospholipid binding motifs that mediate translocation of proteins to membranes, and may also mediate protein-protein interactions. The PI3-kinase activity of this protein is sensitive to low nanomolar levels of the inhibitor wortmanin. The C2 domain of this protein was shown to bind phospholipids but not Ca2+, which suggests that this enzyme may function in a calcium-independent manner.
  • Cellular localization
    Microsome. Cell membrane. Cytoplasm, cytosol. Nucleus. Note=Found mostly in the microsome, but also in the plasma membrane and cytosol. Nuclear in testis.

Images

  • ab159125 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159125 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159125.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up