Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      AYSWQTDPNPNESHEKQYEHQEFLFVNQPHSSSQVSLGFDQIVDEISGKI PHYESEIDENTFFVPTAPKWDSTGHSLNEAHQISLNEFTSKSRELSWHQ
    • Amino acids
      2 to 100
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159126 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • P3C2G_HUMAN
    • Phosphatidylinositol 4 phosphate 3 kinase C2 domain containing gamma polypeptide
    • Phosphatidylinositol-4-phosphate 3-kinase C2 domain-containing subunit gamma
    • Phosphoinositide 3 Kinase C2 gamma
    • Phosphoinositide 3-Kinase-C2-gamma
    • PI3K C2gamma
    • PI3K-C2-gamma
    • PIK3C2G
    • PtdIns 3 kinase C2 gamma
    • PtdIns-3-kinase C2 subunit gamma
    see all
  • Function
    In vitro, phosphorylates PtdIns and PtdIns4P but not PtdIns(4,5)P2.
  • Tissue specificity
    Highly expressed in liver, prostate and testis. Lower levels in small intestine, kidney and pancreas.
  • Sequence similarities
    Belongs to the PI3/PI4-kinase family.
    Contains 1 C2 domain.
    Contains 1 PI3K/PI4K domain.
    Contains 1 PX (phox homology) domain.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab159126 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159126 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159126.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up