Description

  • Product name

    Recombinant Human PIK3IP1 protein
  • Purity

    > 95 % SDS-PAGE.
    Determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Mammalian
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      SGGCFWDNGHLYREDQTSPAPGLRCLNWLDAQSGLASAPVSGAGNHSYCR NPDEDPRGPWCYVSGEAGVPEKRPCEDLRCPETTSQALPAFTTEIQEASE GPGADEVQVFAPANALPARSEAAAVQPVIGISQRVRMNSKEKKDLGTVDH HHHHH
    • Predicted molecular weight

      17 kDa including tags
    • Amino acids

      22 to 168
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Extracellular domain.

Specifications

Our Abpromise guarantee covers the use of ab185388 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C long term. Please see notes section.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione

  • Reconstitution
    Dissolve the lyophilized protein in 3X PBS. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Always centrifuge tubes before opening. Do not mix by vortex or pipetting. Reconstituted protein should be aliquoted and stored at < -20 degrees.

General Info

  • Alternative names

    • HGFL
    • hHGFL(S)
    • Kringle domain containing protein HGFL
    • Kringle domain-containing protein HGFL
    • MGC17330
    • P3IP1_HUMAN
    • Phosphoinositide 3 kinase interacting protein 1
    • Phosphoinositide-3-kinase-interacting protein 1
    • PIK3IP1
    see all
  • Sequence similarities

    Contains 1 kringle domain.
  • Cellular localization

    Membrane.
  • Information by UniProt

References

ab185388 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185388.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up