Description

  • Product name

    Recombinant Human PIK3R5 protein
  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      PI 3 Kinase catalytic subunit gamma ELENYKQPVVLREDNCRRRRRMKPRSAAASLSSMELIPIEFVLPTSQRKC KSPETALLHVAGHGNVEQMKAQVWLRALETSVAADFYHRLGPHHFLLLYQ KKGQWYEIYDKYQVVQTLDCLRYWKATHRSPGQIHLVQRHPPSEESQAFQ RQLTALIGYDVTDVSNVHDDELEFTRRGLVTPRMAEVASRDPKLYAMHPW VTSKPLPEYLWKKIANNCIFIVIHRSTTSQTIKVSPDDTPGAILQSFFTK MAKKKSLMDIPESQSEQDFVLRVCGRDEYLVGETPIKNFQWVRHCLKNGE EIHVVLDTPPDPALDEVRKEEWPLVDDCTGVTGYHEQLTIHGKDHESVFT VSLWDCDRKFRVKIRGIDIPVLPRNTDLTVFVEANIQHGQQVLCQRRTSP KPFTEEVLWNVWLEFSIKIKDLPKGALLNLQIYCGKAPALSSKASAESPS SESKGKVQLLYYVNLLLIDHRFLLRRGEYVLHMWQISGKGEDQGSFNADK LTSATNPDKEN SMSISILLDNYCHPIALPKHQPTPDPEGDRVRAEMPN QLRKQLEAIIATDPLNPLTAEDKELLWHFRYESLKHPKAYPKLFSSVKWG QQEIVAKTYQLLARREVWDQSALDVGLTMQLLDCNFSDENVRAIAVQKLE SLEDDDVLHYLLQLVQAVKFEPYHDSALARFLLKRGLRNKRIGHFLFWFL RSEIAQSRHYQQRFAVILEAYLRGCGTAMLHDFTQQVQVIEMLQKVTLDI KSLSAEKYDVSSQVISQLKQKLENLQNSQLPESFRVPYDPGLKAGALAIE KCKVMASKKKPLWLEFKCADPTALSNETIGIIFKHGDDLRQDMLILQILR IMESIWETESLDLCLLPYGCISTGDKIGMIEIVKDATTIAKIQQSTVGNT GAFKDEVLNHWLKEKSPTEEKFQAAVERFVYSCAGYCVATFVLGIGDRHN DNIMITETGNLFHIDFGHILGNYKSFLGINKERVPFVLTPDFLFVMGTSG KKTSPHFQKFQDICVKAYLALRHHTNLLIILFSMMLMTGMPQLTSKEDIE YIRDALTVGKNEEDAKKYFLDQIEVCRDKGWTVQFNWFLHLVLGIKQGEK HSA
      PIK3R5 MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGL EFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVL DIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFKDRLCHKTYLNGDHVTH PDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIA WPLQGWQATFGGGDHPPKSDPLVPRGSPGEFQPGATTCTEDRIQHALERC LHGLSLSRRSTSWSAGLCLNCWSLQELVSRDPGHFLILLEQILQKTREVQ EKGTYDLLTPLALLFYSTVLCTPHFPPDSDLLLKAASTYHRFLTWPVPYC SICQELLTFIDAELKAPGISYQRLVRAEQGLPIRSHRSSTVTVLLLNPVE VQAEFLAVANKLSTPGHSPHSAYTTLLLHAFQATFGAHCDVPGLHCRLQA KTLAELEDIFTETAEAQELASGIGDAAEARRWLRTKLQAVGEKAGFPGVL DTAKPGKLHTIPIPVARCYTYSWSQDSFDILQEILLKEQELLQPGILGDD EEEEEEEEEVEEDLETDGHCAERDSLLSTSSLASHDSTLSLASSQASGPA LSRHLLTSFVSGLSDGMDSGYVEDSEESSSEWPWRRGSQERRGHRRPGQK FIRIYKLFKSTSQLVLRRDSRSLEGSSDTALPLRRAGSLCSPLDEPVSPP SRAQRSRSLPQPKLGTQLPSWLLAPASRPQRRRPFLSGDEDPKASTLRVV VFGSDRISGKVARAYSNLRRLENNRPLLTRFFKLQFFYVPVKRSHGTSPG ACPPPRSQTPSPPTDSPRHASPGELGTTPWEESTNDISHYLGMLDPWYER NVLGLMHLPPEVLCQQSLKAEAQALEGSPTQLPILADMLLYYCRFAARPV LLQVYQTELTFITGEKTTEIFIHSLELGHSAATRAIKASGPGSKRLGIDG DREAVPLTLQIIYSKGAISGRSRWSNLEKVCTSVNLNKACRKQEELDSSM EALTLNLTEVVKRQNSKSKKGFNQISTSQIKVDKVQIIGSNSCPFAVCLD QDERKILQSVVRCEVSPCYKPEKSDLSSPPQTPPDLPAQAAPDLCSLLCL PIMTFSGALP
    • Predicted molecular weight

      127 kDa including tags
    • Amino acids

      2 to 1102
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab135013 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    Constituents: 0.49% Glutathione, 0.02% Potassium chloride, 0.06% DTT, 0.63% Tris HCl, 20% Glycerol, 0.64% Sodium chloride

General Info

  • Alternative names

    • 5-bisphosphate 3-kinase regulatory subunit
    • F730038I15Rik
    • FOAP 2
    • FOAP2
    • OTTHUMP00000135339
    • p101
    • P101 PI3K
    • p101-PI3K
    • Phosphatidylinositol 4
    • Phosphatidylinositol 4,5 bisphosphate 3 kinase regulatory subunit
    • Phosphoinositide 3 kinase, regulatory subunit 5
    • Phosphoinositide 3 kinase, regulatory subunit 5, p101
    • Phosphoinositide 3 kinase, regulatory subunit, polypeptide p101
    • Phosphoinositide 3-kinase regulatory subunit 5
    • PI3 kinase p101 subunit
    • PI3 kinase regulatory subunit 5
    • PI3-kinase p101 subunit
    • PI3-kinase regulatory subunit 5
    • PI3R5_HUMAN
    • PIK3 R5
    • PIK3R5
    • Protein FOAP 2
    • Protein FOAP-2
    • PtdIns 3 kinase p101
    • PtdIns 3 kinase regulatory subunit
    • PtdIns-3-kinase p101
    • PtdIns-3-kinase regulatory subunit
    see all
  • Function

    Regulatory subunit of the PI3K gamma complex.
  • Tissue specificity

    Ubiquitously expressed with high expression in fetal brain compared to adult brain. Abundant expression is observed in cerebellum, cerebral cortex, cerebral meninges, and vermis cerebelli.
  • Involvement in disease

    Note=Defects in PIK3R5 may be a cause of autosomal recessive ataxia with oculomotor apraxia (AOA). A PIK3R5 mutation segregates with the disease phenotype in a family affected by gait ataxia, cerebellar dysarthric speech, and impaired ocular movement. Additional features include reduced or absent tendon reflexes, severe cerebellar atrophy, marked vermal atrophy, moderately severe axonal sensory polyneuropathy with absent sensory nerve action potential in the lower extremities, and persistently elevated alpha-fetoprotein levels.
  • Domain

    The heterodimerization region allows the binding to the catalytic subunit.
  • Cellular localization

    Nucleus. Cytoplasm. Membrane.
  • Information by UniProt

Images

  • 10% SDS-PAGE analysis of ab135013 (1.4µg) stained with Coomassie Blue. Upper arrow PI 3 Kinase catalytic subunit gamma, lower arrow PIK3R5.

References

ab135013 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab135013.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up