Description

  • Product name

    Recombinant Human PIM2 protein
    See all PIM2 proteins and peptides
  • Purity

    > 85 % SDS-PAGE.
    ab181913 was purified by using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMLTKPLQGPPAPPGTPTPPPGGKDREA FEAEYRLGPLLGKGGFGTVFAGHRLTDRLQVAIKVIPRNRVLGWSPLSDS VTCPLEVALLWKVGAGGGHPGVIRLLDWFE TQEGFMLVLERPLPAQDLFDYITEKGPLGEGPSRCFFGQVVAAIQHCHSR GVVHRDIKDENILIDLRRGCAKLIDFGSGALLHDEPYTDFDGTRVYSPPE WISRHQYHALPATVWSLGILLYDMVCGDIPFERDQEILEAELHFPAHVSP DCCALIRRCLAPKPSSRPSLEEILLDPWMQTPAEDVPLNPSKGGPAPLAW SLLP
    • Predicted molecular weight

      37 kDa including tags
    • Amino acids

      1 to 311
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_006866.

Specifications

Our Abpromise guarantee covers the use of ab181913 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.32% Tris HCl, 0.58% Sodium chloride, 10% Glycerol

General Info

  • Alternative names

    • OTTHUMP00000025825
    • Pim 2 oncogene
    • Pim 2h
    • Pim-2h
    • PIM2
    • PIM2 Oncogene
    • PIM2_HUMAN
    • Pim2h
    • Proto Oncogene PIM2
    • Proto-oncogene Pim-2 (serine threonine kinase)
    • Serine/threonine kinase PIM2
    • Serine/threonine-protein kinase Pim-2
    see all
  • Function

    Promotes cell survival in response to a variety of proliferative signals via positive regulation of the I-kappaB kinase/NF-kappaB cascade; this process requires phosphorylation of MAP3K8/COT. Prevents apoptosis induced by growth factor withdrawal via inhibition of caspase-3 activation, and via phosphorylation of pro-apoptotic proteins. Inhibits BAD-induced cell death via phosphorylation of BAD. PIM2-mediated cell survival is glucose-dependent but independent of several AKT regulators such as PI3K, HSP-90 and TOR, indicating that PIM2 and PI3K/AKT/TOR function via distinct pathways. Involved in the positive regulation of chondrocyte survival and autophagy in the epiphyseal growth plate.
  • Tissue specificity

    Highly expressed in hematopoietic tissues, in leukemic and lymphoma cell lines, testis, small intestine, colon and colorectal adenocarcinoma cells. Weakly expressed in normal liver, but highly expressed in hepatocellular carcinoma tissues.
  • Sequence similarities

    Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. PIM subfamily.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications

    Autophosphorylated.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab181913 (3µg).

References

ab181913 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Abreviews
Application
Other
Pim-2 Kinase assay comparing kinase activity of the ab181913 Recombinant human PIM2-His6 protein with recombinant human PIM2-GST protein from ThermoFisher (Cat# PV3649)

P14 rat brain lysate was phosphorylated with 0.15 µg of Pim 2 kinase

Abcam user community

Verified customer

Submitted Jun 28 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up