Description

  • Product name

    Recombinant Human Pinkbar protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAPEMDQFYRSTMAIYKSIMEQFNPALENLVYLGNNYLRAFHALSEAAEV YFSAIQKIGERALQSPTSQILGEILVQMSDTQRHLNSDLEVVVQTFHGGL LQHMEKNTKLDMQFIKDSRQHYELEYRHRAANLEKCMSELWRMERKRDKN VREMKESVNRLHAQMQAFVSESQRAAELEEKRRYRFLAEKHLLLSNTFLQ FFGRARGMLQNRVLLWKEQSEASRSPSRAHSPGLLGPALGPPYPSGRLTP TRLDMPPRPLGEFSSPRSRHGSGSYGTEPDARPASQLEPDRRSLPRTPSA SSLYSGSAQSSRSNSFGERPGGGGGARRVRALVSHSEGANHTLLRFSAGD VVEVLVPEAQNGWLYGKLEGSSASGWFPEAYVKALEEGPVNPMTPVTPMT SMTSMSPMTPMTPMNPGNELPSRSYPLRGSHSLDDLLDRPGNSTPSRVPS RAPSPAPPPLPSSRRSSMGSTAVATDVKKLMSSEQYPPQELFPRGTNPFA TVKLRPTITNDRSAPLIR
    • Amino acids

      1 to 518
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164198 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as BAIAP2L2.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • BAI1-associated protein 2-like 2
    • BAI1-associated protein 2-like protein 2
    • baiap2l2
    • BAIAP2L2 BAI1-associated protein 2-like 2
    • BC048937
    • BI2L2_HUMAN
    • Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 2
    • FLJ22582
    • Pinkbar
    • Planar intestinal- and kidney-specific BAR domain protein
    • RP5-1039K5.3
    see all
  • Function

    May function as an adapter protein.
  • Sequence similarities

    Contains 1 IMD (IRSp53/MIM homology) domain.
    Contains 1 SH3 domain.
  • Domain

    The IMD domain is predicted to have a helical structure. It may induce actin bundling and filopodia formation.
  • Information by UniProt

Images

  • ab164198 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164198 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164198.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up